5L11: Human Liver Receptor Homologue-1

Human Liver Receptor Homologue-1 (LRH-1) Bound to RJW100 and a Fragment of TIF-2. Determined by X-ray diffraction at 1.85 Å resolution. Released 12 Oct 2016.

Method: X-ray diffraction
Resolution: 1.85 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,129
Mol. weight: 30.43 kDa
Ligands: RJW
Released: 12 Oct 2016

Explore 5L11 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L11 contains 14 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	303-310	8
α-helix	315-332	18
α-helix	335-337	3
α-helix	338-340	3
α-helix	341-362	22
α-helix	366-368	3
α-helix	371-397	27
α-helix	398-399	2
β-strand	402-404	3	1
β-strand	410-412	3	1
α-helix	413-440	28
α-helix	445-456	12
α-helix	467-488	22
α-helix	495-522	28
α-helix	531-535	5

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	743-750	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear receptor subfamily 5 group A member 2	A	protein	245	Homo sapiens	O00482 (AlphaFold model)
Tif2	C	protein	14	Homo sapiens	Q15596 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5L11_1 Nuclear receptor subfamily 5 group A member 2 (chains A)
SNASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSI
VEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSII
ASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQ
VNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEML
HAKRA

Sequence of entity 2 (C), FASTA

>5L11_2 Tif2 (chains C)
KENALLRYLLDKDD

Ligands and cofactors

ID	Name	Formula	Copies
RJW	(1R,3aR,6aR)-5-hexyl-4-phenyl-3a-(1-phenylethenyl)-1,2,3,3a,6,6a-hexahydropenta…	C28 H34 O	1

Primary citation

Crystal Structures of the Nuclear Receptor, Liver Receptor Homolog 1, Bound to Synthetic Agonists. Mays, S.G., Okafor, C.D., Whitby, R.J. et al. J Biol Chem (2016) 291:25281-25291. DOI 10.1074/jbc.M116.753541 · PubMed

Other PDB entries of the same protein (UniProt O00482 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6VC2 1.7 Å, LRH-1 bound to SS-RJW100 and a fragment of the Tif2 Coactivator
3PLZ 1.75 Å, Human LRH1 LBD bound to GR470
4PLD 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
4PLE 1.75 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to an E. Coli…
4ONI 1.8 Å, Structure of Human Orphan Receptor LRH1 bound to two bacterial phospholipids
4RWV 1.86 Å, Crystal structure of PIP3 bound human nuclear receptor LRH-1 (Liver Receptor Homolog 1,…
1YUC 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to Phospholipid and a…
4DOR 1.9 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, in its apo State Bound to a…
5SYZ 1.93 Å, Human Liver Receptor Homologue-1 (LRH-1) Bound to a RJW100 stereoisomer and a Fragment…
5UNJ 1.96 Å, Structure of Human Liver Receptor Homolog 1 in complex with PGC1a and RJW100
4DOS 2.0 Å, Human Nuclear Receptor Liver Receptor Homologue-1, LRH-1, Bound to DLPC and a Fragment…
6OQX 2.0 Å, Human Liver Receptor Homolog-1 bound to the agonist 5N and a fragment of the Tif2…

Browse structure collections

About this viewer

MolViewer shows 5L11 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.