5L6W: LIMK1-ATPgammaS-CFL1 Complex

Structure Of the LIMK1-ATPgammaS-CFL1 Complex. Determined by X-ray diffraction at 2.53 Å resolution. Released 8 Jun 2016.

Method: X-ray diffraction
Resolution: 2.53 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,398
Mol. weight: 55.15 kDa
Ligands: AGS
Released: 8 Jun 2016

Explore 5L6W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L6W contains 24 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 9 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	5	1
β-strand	6-7	2	5
α-helix	8	1
α-helix	9-19	11
α-helix	26-31	6
β-strand	33-40	8	5
β-strand	46-56	11	5
α-helix	57-59	3
β-strand	60	1	6
β-strand	64	1	6
α-helix	67-74	8
β-strand	81-90	10	5
β-strand	95-104	10	5
α-helix	111-127	17
β-strand	134-137	4	5
α-helix	140-144	5
α-helix	147-154	8
β-strand	160-161	2	5
β-strand	165	1	5

Chain L: 15 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	329-331	3
β-strand	332-333	2	1
α-helix	336-338	3
β-strand	339-346	8	1
β-strand	351-358	8	1
β-strand	364-370	7	1
α-helix	375-389	15
β-strand	396	1	2
α-helix	397-398	2
β-strand	399-404	6	1
β-strand	409-414	6	1
β-strand	420	1	2
α-helix	421-426	6
α-helix	434-453	20
β-strand	456-457	2	3
β-strand	466-468	3	2
β-strand	474-476	3	2
β-strand	483-484	2	3
α-helix	518-521	4
α-helix	529-544	16
β-strand	555	1	4
β-strand	561	1	4
α-helix	563-569	7
α-helix	575-576	2
α-helix	579-586	8
α-helix	595-596	2
α-helix	597-612	16
α-helix	615-618	4
α-helix	619-631	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LIM domain kinase 1	L	protein	310	Homo sapiens	P53667 (AlphaFold model)
Cofilin-1	C	protein	167	Homo sapiens	P23528 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>5L6W_1 LIM domain kinase 1 (chains L)
SMPHRIFRPSDLIHGEVLGKGCFGQAIKVTHRETGEVMVMKELIRFDEETQRTFLKEVKV
MRCLEHPNVLKFIGVLYKDKRLNFITEYIKGGTLRGIIKSMDSQYPWSQRVSFAKDIASG
MAYLHSMNIIHRDLNSHNCLVRENKNVVVADFGLARLMVDEKTQPEGLRSLKKPDRKKRY
TVVGNPYWMAPEMINGRSYDEKVDVFSFGIVLCEIIGRVNADPDYLPRTMDFGLNVRGFL
DRYCPPNCPPSFFPITVRCCDLDPEKRPSFVKLEHWLETLRMHLAGHLPLGPQLEQLDRG
FWETYRRGES

Sequence of entity 2 (C), FASTA

>5L6W_2 Cofilin-1 (chains C)
SMACGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGD
VGQTVDDPYATFVKMLPDKDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYAS
SKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKLGGSAVISLEGKPL

Ligands and cofactors

ID	Name	Formula	Copies
AGS	Phosphothiophosphoric acid-adenylate ester	C10 H16 N5 O12 P3 S	1

Primary citation

Structure Of the LIMK1-ATPgammaS-CFL1 Complex. Salah, E., Bullock, A.N. To be published.

Other PDB entries of the same protein (UniProt P53667 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3S95 1.65 Å, Crystal structure of the human LIMK1 kinase domain in complex with staurosporine
8AAU 1.74 Å, LIM Domain Kinase 1 (LIMK1) bound to LIMKi3
6WLY 1.9 Å, PAK4 kinase domain in complex with LIMK1 Thr508 substrate peptide
9Z6D 1.94 Å, Crystal structure of LIMK1 mutant D460N bound to small molecule inhibitor cLIMK1i
5HVJ 2.2 Å, Crystal structure of LIMK1 D460N mutant in complex with AMP-PNP
5NXC 2.25 Å, LIM Domain Kinase 1 (LIMK1) In Complex With PF-00477736
9Z6E 2.26 Å, Crystal structure of apo LIMK1 mutant D460N
7ATS 2.8 Å, The LIMK1 Kinase Domain Bound To LIJTF500127
7ATU 2.8 Å, The LIMK1 Kinase Domain Bound To LIJTF500025
7B8W 2.8 Å, Structure of LIMK1 Kinase domain with allosteric inhibitor TH-470
5HVK 3.5 Å, Crystal structure of LIMK1 mutant D460N in complex with full-length cofilin-1

Browse structure collections

About this viewer

MolViewer shows 5L6W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.