Hif prolyl hydroxylase 2 (PHD2/ EGLN1) in complex with 2-oxoglutarate (2OG) and hif-1ALPHA codd (556-574). Determined by X-ray diffraction at 1.95 Å resolution. Released 31 Aug 2016.
Explore 5L9B in 3D Show helices and sheets RCSB PDB PDBe
5L9B contains 23 α-helices and 39 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-193 | 4 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-205 | 7 | |
| β-strand | 207-210 | 4 | 1 |
| α-helix | 216-231 | 16 | |
| β-strand | 236-237 | 2 | 1 |
| β-strand | 240 | 1 | 2 |
| α-helix | 248-250 | 3 | |
| β-strand | 252 | 1 | 3 |
| β-strand | 255-259 | 5 | 1 |
| α-helix | 267-283 | 17 | |
| β-strand | 292-295 | 4 | 1 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-303 | 6 | 1 |
| β-strand | 308-313 | 6 | 3 |
| β-strand | 322-329 | 8 | 1 |
| β-strand | 331 | 1 | 4 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 3 |
| β-strand | 343-345 | 3 | 3 |
| β-strand | 354-356 | 3 | 3 |
| β-strand | 359 | 1 | 4 |
| β-strand | 363-367 | 5 | 1 |
| β-strand | 374-379 | 6 | 3 |
| β-strand | 383-392 | 10 | 1 |
| α-helix | 393-404 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 190-193 | 4 | |
| α-helix | 194-198 | 5 | |
| α-helix | 199-205 | 7 | |
| β-strand | 207-210 | 4 | 5 |
| α-helix | 216-231 | 16 | |
| β-strand | 236-237 | 2 | 5 |
| β-strand | 240 | 1 | 6 |
| α-helix | 248-250 | 3 | |
| β-strand | 252 | 1 | 7 |
| β-strand | 255-259 | 5 | 5 |
| α-helix | 267-282 | 16 | |
| β-strand | 292-295 | 4 | 5 |
| α-helix | 296-297 | 2 | |
| β-strand | 298-304 | 7 | 5 |
| β-strand | 310-313 | 4 | 7 |
| β-strand | 322-329 | 8 | 5 |
| β-strand | 331 | 1 | 8 |
| α-helix | 336-339 | 4 | |
| β-strand | 340 | 1 | 9 |
| β-strand | 343-345 | 3 | 7 |
| β-strand | 354-356 | 3 | 7 |
| β-strand | 359 | 1 | 8 |
| β-strand | 363-367 | 5 | 5 |
| β-strand | 374-376 | 3 | 7 |
| β-strand | 379 | 1 | 9 |
| β-strand | 382-392 | 11 | 5 |
| α-helix | 393-404 | 12 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 559-562 | 4 | |
| β-strand | 564 | 1 | 2 |
| α-helix | 565 | 1 | |
| β-strand | 572-573 | 2 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 559-561 | 3 | |
| β-strand | 564 | 1 | 6 |
| α-helix | 565 | 1 | |
| α-helix | 571 | 1 | |
| β-strand | 572-573 | 2 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Egl nine homolog 1 | A, B | protein | 252 | Homo sapiens | Q9GZT9 (AlphaFold model) |
| Hypoxia-inducible factor 1-alpha | C, D | protein | 19 | Homo sapiens | Q16665 (AlphaFold model) |
>5L9B_1 Egl nine homolog 1 (chains A, B) GSHMASPNGQTKPLPALKLALEYIVPAMNKHGICVVDDFLGKETGQQIGDEVRALHDTGK FTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIGLLMSSMDDLIRHCNGKLGSYKING RTKAMVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFA DIEPKFDRLLFFWSDRRNPHEVQPAYATRYAITVWYFDADERAAAKVKYLTGEKGVRVEL NKPSDSVGKDVF
>5L9B_2 Hypoxia-inducible factor 1-alpha (chains C, D) DLDLEMLAPYIPMDDDFQL
Structural basis for oxygen degradation domain selectivity of the HIF prolyl hydroxylases. Chowdhury, R., Leung, I.K., Tian, Y.M. et al. Nat Commun (2016) 7:12673-12673. DOI 10.1038/ncomms12673 · PubMed
Other PDB entries of the same protein (UniProt Q9GZT9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5L9B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.