5LNB: De-sumoylating protease

Crystal structure of the de-sumoylating protease. Determined by X-ray diffraction at 2.3 Å resolution. Released 16 Aug 2017.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 1
Atoms: 2,377
Mol. weight: 36.67 kDa
Released: 16 Aug 2017

Explore 5LNB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LNB contains 20 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 20 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	26	1
β-strand	27-30	4	1
β-strand	36-39	4	1
α-helix	41-44	4
α-helix	45-47	3
α-helix	51-54	4
α-helix	55-71	17
α-helix	77-79	3
β-strand	80-82	3	2
α-helix	83-84	2
α-helix	86-91	6
α-helix	98-102	5
α-helix	111-113	3
β-strand	116-123	8	2
β-strand	126-133	8	2
α-helix	135-140	6
β-strand	163-168	6	2
α-helix	176-194	19
α-helix	200-202	3
β-strand	203-207	5	2
α-helix	216-218	3
α-helix	219-232	14
α-helix	234-242	9
α-helix	249-259	11
α-helix	262-265	4
α-helix	268-289	22
α-helix	293-298	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like-specific protease 2	B	protein	310	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P40537 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>5LNB_1 Ubiquitin-like-specific protease 2 (chains B)
SSNSEFDDATTEFETPELFKPSLCYKFNDGSSYTITNQDFKCLFNKDWVNDSILDFFTKF
YIESSIEKSIIKREQVHLMSSFFYTKLISNPADYYSNVKKWVNNTDLFSKKYVVIPINIS
YHWFSCIITNLDAILDFHQNKDKNDAINSDEISINNPLVNILTFDSLRQTHSREIDPIKE
FLISYALDKYSIQLDKTQIKMKTCPVPQQPNMSDCGVHVILNIRKFFENPVETIDVWKNS
KIKSKHFTAKMINKYFDKNERNSARKNLRHTLKLLQLNYISYLKKENLYEEVMQMEEKKS
TGGGHHHHHH

Primary citation

Crystal structure of the de-sumoylating protease. Eckhoff, J., Dohmen, J., Pichlo, C. et al. To be published.

Other PDB entries of the same protein (UniProt P40537 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V1A 2.14 Å, Structure of S. cerevisiae Ulp2:Csm1 complex

Browse structure collections

About this viewer

MolViewer shows 5LNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.