5V1A: S. cerevisiae Ulp2:Csm1 complex

Structure of S. cerevisiae Ulp2:Csm1 complex. Determined by X-ray diffraction at 2.14 Å resolution. Released 17 May 2017.

Method: X-ray diffraction
Resolution: 2.14 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 1,019
Mol. weight: 17.03 kDa
Released: 17 May 2017

Explore 5V1A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5V1A contains 6 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	71-82	12
β-strand	84-91	8	1
β-strand	96-102	7	1
β-strand	116-123	8	1
β-strand	131-136	6	1
α-helix	143-152	10
α-helix	155-158	4
β-strand	161-164	4	1
α-helix	165-167	3
α-helix	168-179	12

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	832-839	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like-specific protease 2	B	protein	26	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P40537 (AlphaFold model)
Monopolin complex subunit CSM1	A	protein	122	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P25651 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>5V1A_1 Ubiquitin-like-specific protease 2 (chains B)
AEFTSPYFGRPSLKTRAKQFEGVSSP

Sequence of entity 2 (A), FASTA

>5V1A_2 Monopolin complex subunit CSM1 (chains A)
ENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHSGGSSDDYSIMDYKLGFVKGQAQ
VTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLNKKREKKDE
TE

Primary citation

Recruitment of a SUMO isopeptidase to rDNA stabilizes silencing complexes by opposing SUMO targeted ubiquitin ligase activity. Liang, J., Singh, N., Carlson, C.R. et al. Genes Dev (2017) 31:802-815. DOI 10.1101/gad.296145.117 · PubMed

Other PDB entries of the same protein (UniProt P40537 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LNB 2.3 Å, Crystal structure of the de-sumoylating protease

Browse structure collections

About this viewer

MolViewer shows 5V1A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.