5LTL: Human chemokine CCL16

Structure of human chemokine CCL16. Determined by X-ray diffraction at 1.45 Å resolution. Released 9 May 2018.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,238
Mol. weight: 23.03 kDa
Released: 9 May 2018

Explore 5LTL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LTL contains 7 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
α-helix	22-24	3
α-helix	25-27	3
β-strand	28-34	7	2
β-strand	41-46	6	2
β-strand	51-54	4	2
α-helix	59-66	8
β-strand	72	1	2

Chain B: 4 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	12-14	3	1
α-helix	22-24	3
α-helix	25-27	3
β-strand	28-34	7	3
β-strand	41-46	6	3
β-strand	51-54	4	3
α-helix	59-65	7
α-helix	70-71	2
β-strand	72	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 16	A, B	protein	100	Homo sapiens	O15467 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5LTL_1 C-C motif chemokine 16 (chains A, B)
GPSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPN
DDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ

Primary citation

Structure and dynamics of human chemokine CCL16. Weiergraeber, O.H., Petrovic, D., Kislat, A. et al. To be published.

Other PDB entries of the same protein (UniProt O15467 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7SCT 1.84 Å, Crystal Structure of the Tick Evasin EVA-AAM1001 Complexed to Human Chemokine CCL16
8FK9 2.7 Å, Crystal Structure of the Tick Evasin EVA-ACA1001 Complexed to Human Chemokine CCL16

Browse structure collections

About this viewer

MolViewer shows 5LTL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.