Structure of the Yellow-Green Fluorescent Protein mNeonGreen from Branchiostoma lanceolatum at the near physiological pH 8.0. Determined by X-ray diffraction at 1.21 Å resolution. Released 7 Dec 2016.
Explore 5LTR in 3D Show helices and sheets RCSB PDB PDBe
5LTR contains 5 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 6-15 | 10 | 1 |
| β-strand | 18-29 | 12 | 1 |
| β-strand | 34-41 | 8 | 1 |
| α-helix | 50-53 | 4 | |
| α-helix | 62-64 | 3 | |
| β-strand | 66-67 | 2 | 2 |
| β-strand | 70-71 | 2 | 2 |
| α-helix | 73-79 | 7 | |
| β-strand | 84-92 | 9 | 1 |
| β-strand | 97-107 | 11 | 1 |
| β-strand | 110-120 | 11 | 1 |
| β-strand | 133-136 | 4 | 1 |
| β-strand | 139-147 | 9 | 1 |
| β-strand | 150-161 | 12 | 1 |
| β-strand | 166-177 | 12 | 1 |
| α-helix | 180-182 | 3 | |
| α-helix | 183-187 | 5 | |
| β-strand | 191-201 | 11 | 1 |
| β-strand | 205-215 | 11 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| mNeonGreen | A | protein | 269 | Branchiostoma lanceolatum | B1PNC0 (AlphaFold model) |
>5LTR_1 mNeonGreen (chains A) MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDPLEMVSKGEEDNMASLPATHELHIFGSI NGVDFDMVGQGTGNPNDGYEELNLKSTKGDLQFSPWILVPHIGYGFHQYLPYPDGMSPFQ AAMVDGSGYQVHRTMQFEDGASLTVNYRYTYEGSHIKGEAQVKGTGFPADGPVMTNSLTA ADWCRSKKTYPNDKTIISTFKWSYTTGNGKRYRSTARTTYTFAKPMAANYLKNQPMYVFR KTELKHSKTELNFKEWQKAFTDVMGMDELYK
Structural analysis of the bright monomeric yellow-green fluorescent protein mNeonGreen obtained by directed evolution. Clavel, D., Gotthard, G., von Stetten, D. et al. Acta Crystallogr D Struct Biol (2016) 72:1298-1307. DOI 10.1107/S2059798316018623 · PubMed
Other PDB entries of the same protein (UniProt B1PNC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
5LTR is part of these collections:
MolViewer shows 5LTR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.