5LX2: Lt 14-3-3

Lt 14-3-3 in complex with PI4KIIIB peptide. Determined by X-ray diffraction at 2.58 Å resolution. Released 16 Nov 2016.

Method: X-ray diffraction
Resolution: 2.58 Å
Organisms: Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284), Homo sapiens
Chains: 2
Atoms: 1,927
Mol. weight: 29.3 kDa
Released: 16 Nov 2016

Explore 5LX2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LX2 contains 14 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	5-17	13
α-helix	21-32	12
α-helix	37-38	2
α-helix	40-71	32
α-helix	79-105	27
α-helix	106-110	5
α-helix	111-113	3
α-helix	117-137	21
α-helix	141-164	24
α-helix	170-181	12
α-helix	182-186	5
α-helix	190-207	18
α-helix	208-210	3
α-helix	213-236	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
KLTH0G14146p	A	protein	253	Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284)	C5DN49 (AlphaFold model)
Phosphatidylinositol 4-kinase beta	B	protein	6	Homo sapiens	Q9UBF8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5LX2_1 KLTH0G14146p (chains A)
MSQSREDSVYLAKLAEQAERYEEMVDSMKAVASSGQELSVEERNLLSVAYKNVIGARRAS
WRIVSSIEQKEEAKDKSEHQVKLIRDYRSKIETELTKICDDILSVLDTHLIPSATTGESK
VFYYKMKGDYHRYLAEFSSGEVRDKATNASLEAYKTASEIATTELPPTHPIRLGLALNFS
VFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMSEA
GQDEQQPAEGAQE

Sequence of entity 2 (B), FASTA

>5LX2_2 Phosphatidylinositol 4-kinase beta (chains B)
TASNPK

Primary citation

Lt 14-3-3 in complex with PI4KIIIB peptide. Boura, E., Eisenreichova, A. To be published.

Other PDB entries of the same protein (UniProt C5DN49 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LVZ 1.95 Å, Crystal structure of yeast 14-3-3 protein from Lachancea thermotolerans

Browse structure collections

About this viewer

MolViewer shows 5LX2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.