5M4S: PDB entry 5M4S

Name: PDB 5M4S: Transcription factor TFIIA as a single chain protein
Published: 2017-11-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Transcription factor TFIIA as a single chain protein. Determined by X-ray diffraction at 2.38 Å resolution. Released 29 Nov 2017.

Method: X-ray diffraction
Resolution: 2.38 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,739
Mol. weight: 24.13 kDa
Released: 29 Nov 2017

Explore 5M4S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5M4S contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	4-7	4
α-helix	10-24	15
α-helix	30-51	22
β-strand	55-68	14	1
β-strand	71-82	12	1
β-strand	87-99	13	1
α-helix	115-133	19
α-helix	138-154	17
α-helix	164-167	4
β-strand	168-179	12	1
β-strand	182-194	13	1
β-strand	197-209	13	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor IIA subunit 2,Transcription initiation factor IIA subunit…	A	protein	209	Homo sapiens	P52655 (AlphaFold model), P52657 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5M4S_1 Transcription initiation factor IIA subunit 2,Transcription initiation factor IIA subunit 1,Transcription initiation factor IIA subunit 1 (chains A)
AYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGS
LNTYRFCDNVWTFVLNDVEVREVTELIKVDKVKIVACDGKNTANSANTNTVPKLYRSVIE
DVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGELFDTENVVVCQYDKIHRSKN
KWKFHLKDGIMNLNGRDYIFSKAIGDAEW

Primary citation

Architecture of TAF11/TAF13/TBP complex suggests novel regulation properties of general transcription factor TFIID. Gupta, K., Watson, A.A., Baptista, T. et al. Elife (2017) 6. DOI 10.7554/eLife.30395 · PubMed

Other PDB entries of the same protein (UniProt P52655 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1NVP 2.1 Å, Human tfiia/tbp/dna complex
7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…
7NVT 2.9 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in distal position
8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt
7ZWD 3.0 Å, Structure of SNAPc containing Pol II pre-initiation complex bound to U5 snRNA promoter…
7ZX8 3.0 Å, Structure of SNAPc containing Pol II pre-initiation complex bound to U1 snRNA promoter…
8S51 3.1 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 8 nt
7ZWC 3.2 Å, Structure of SNAPc:TBP-TFIIA-TFIIB sub-complex bound to U5 snRNA promoter
7EGB 3.3 Å, TFIID-based holo PIC on SCP promoter
7ZX7 3.4 Å, Structure of SNAPc containing Pol II pre-initiation complex bound to U1 snRNA promoter…
8S5N 3.4 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 12 nt

Browse structure collections

About this viewer

MolViewer shows 5M4S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.