5M97: Mal3 EB1-like domain

Structure of the Mal3 EB1-like domain. Determined by X-ray diffraction at 1.33 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 1.33 Å
Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843)
Chains: 2
Atoms: 1,255
Mol. weight: 18.06 kDa
Released: 7 Dec 2016

Explore 5M97 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5M97 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	7-50	44
α-helix	57-69	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule integrity protein mal3	A, B	protein	77	Schizosaccharomyces pombe (strain 972 / ATCC 24843)	Q10113 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5M97_1 Microtubule integrity protein mal3 (chains A, B)
SGSAKQAQQQITSLETQLYEVNETMFGLERERDFYFNKLREIEILVQTHLTTSPMSMENM
LERIQAILYSTEDGFEL

Primary citation

An unconventional interaction between Dis1/TOG and Mal3/EB1 in fission yeast promotes the fidelity of chromosome segregation. Matsuo, Y., Maurer, S.P., Yukawa, M. et al. J Cell Sci (2016) 129:4592-4606. DOI 10.1242/jcs.197533 · PubMed

Other PDB entries of the same protein (UniProt Q10113 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M9E 2.83 Å, Interactions between the Mal3 EB1-like domain and Dis1
5MJS 4.6 Å, S. pombe microtubule copolymerized with GTP and Mal3-143
4ABO 8.6 Å, Mal3 CH domain homology model and mammalian tubulin (2XRP) docked into the 8.6-Angstrom…

Browse structure collections

About this viewer

MolViewer shows 5M97 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.