Structure of the Mal3 EB1-like domain. Determined by X-ray diffraction at 1.33 Å resolution. Released 7 Dec 2016.
Explore 5M97 in 3D Show helices and sheets RCSB PDB PDBe
5M97 contains 4 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-50 | 44 | |
| α-helix | 57-69 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Microtubule integrity protein mal3 | A, B | protein | 77 | Schizosaccharomyces pombe (strain 972 / ATCC 24843) | Q10113 (AlphaFold model) |
>5M97_1 Microtubule integrity protein mal3 (chains A, B) SGSAKQAQQQITSLETQLYEVNETMFGLERERDFYFNKLREIEILVQTHLTTSPMSMENM LERIQAILYSTEDGFEL
An unconventional interaction between Dis1/TOG and Mal3/EB1 in fission yeast promotes the fidelity of chromosome segregation. Matsuo, Y., Maurer, S.P., Yukawa, M. et al. J Cell Sci (2016) 129:4592-4606. DOI 10.1242/jcs.197533 · PubMed
Other PDB entries of the same protein (UniProt Q10113 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5M97 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.