5M9E: Microtubule integrity protein mal3

Interactions between the Mal3 EB1-like domain and Dis1. Determined by X-ray diffraction at 2.83 Å resolution. Released 7 Dec 2016.

Method: X-ray diffraction
Resolution: 2.83 Å
Organisms: Schizosaccharomyces pombe 972h-, Schizosaccharomyces pombe
Chains: 8
Atoms: 2,805
Mol. weight: 45.32 kDa
Released: 7 Dec 2016

Explore 5M9E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5M9E contains 12 α-helices and 4 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	175-220	46
α-helix	227-238	12

Chain C: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	175-217	43
α-helix	218-222	5
α-helix	227-238	12

Chains E and F: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	835	1	1
α-helix	842-845	4
β-strand	848	1	2

Chain G: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	842-844	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule integrity protein mal3	A, B, C, D	protein	77	Schizosaccharomyces pombe 972h-	Q10113 (AlphaFold model)
Phosphoprotein p93	E, F, G, H	protein	20	Schizosaccharomyces pombe	Q09933 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5M9E_1 Microtubule integrity protein mal3 (chains A, B, C, D)
SGSAKQAQQQITSLETQLYEVNETMFGLERERDFYFNKLREIEILVQTHLTTSPMSMENM
LERIQAILYSTEDGFEL

Sequence of entity 2 (E, F, G, H), FASTA

>5M9E_2 Phosphoprotein p93 (chains E, F, G, H)
RRSLAGSMLQKPTQFSRPSF

Primary citation

An unconventional interaction between Dis1/TOG and Mal3/EB1 in fission yeast promotes the fidelity of chromosome segregation. Matsuo, Y., Maurer, S.P., Yukawa, M. et al. J Cell Sci (2016) 129:4592-4606. DOI 10.1242/jcs.197533 · PubMed

Other PDB entries of the same protein (UniProt Q10113 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5M97 1.33 Å, Structure of the Mal3 EB1-like domain
5MJS 4.6 Å, S. pombe microtubule copolymerized with GTP and Mal3-143
4ABO 8.6 Å, Mal3 CH domain homology model and mammalian tubulin (2XRP) docked into the 8.6-Angstrom…

Browse structure collections

About this viewer

MolViewer shows 5M9E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.