5MC9: Laminin subunit alpha-1

Crystal structure of the heterotrimeric integrin-binding region of laminin-111. Determined by X-ray diffraction at 2.13 Å resolution. Released 8 Feb 2017.

Method: X-ray diffraction
Resolution: 2.13 Å
Organism: Mus musculus
Chains: 3
Atoms: 5,626
Mol. weight: 83.16 kDa
Ligands: CA
Released: 8 Feb 2017

Explore 5MC9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MC9 contains 15 α-helices and 49 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 48 β-strands

Element	Residues	Length	Sheet
α-helix	2090-2092	3
α-helix	2093-2122	30
α-helix	2126	1
β-strand	2127-2131	5	1
β-strand	2135-2138	4	2
β-strand	2147-2155	9	1
β-strand	2161-2167	7	2
β-strand	2174-2180	7	2
β-strand	2183-2189	7	2
β-strand	2194-2199	6	2
β-strand	2210-2217	8	1
β-strand	2220-2227	8	1
α-helix	2234-2236	3
β-strand	2237-2240	4	1
β-strand	2255-2257	3	2
β-strand	2277-2280	4	1
β-strand	2284-2285	2	1
β-strand	2288-2289	2	1
β-strand	2297-2299	3	2
β-strand	2303-2305	3	1
α-helix	2311	1
β-strand	2312	1	3
β-strand	2316-2326	11	4
β-strand	2334-2342	9	4
β-strand	2348-2353	6	4
β-strand	2361-2367	7	4
β-strand	2370-2376	7	4
β-strand	2381-2385	5	4
β-strand	2396-2403	8	4
β-strand	2406-2413	8	4
β-strand	2416-2426	11	4
β-strand	2442-2444	3	4
β-strand	2446	1	5
β-strand	2461	1	5
β-strand	2463-2471	9	4
β-strand	2474-2475	2	4
β-strand	2482-2487	6	4
α-helix	2491-2493	3
β-strand	2496-2507	12	6
β-strand	2512	1	7
β-strand	2517-2524	8	6
β-strand	2529-2535	7	6
β-strand	2551-2557	7	6
β-strand	2560-2566	7	6
α-helix	2571-2573	3
β-strand	2574-2578	5	6
β-strand	2591-2598	8	6
β-strand	2601-2606	6	6
α-helix	2610-2611	2
β-strand	2612-2615	4	6
α-helix	2618-2620	3
β-strand	2625	1	7
β-strand	2629-2632	4	6
α-helix	2648	1
β-strand	2649	1	6
α-helix	2650	1
β-strand	2652-2659	8	6
β-strand	2662-2663	2	6
α-helix	2666-2668	3
β-strand	2671-2677	7	6

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	1739-1784	46

Chain C: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	1555-1593	39
α-helix	1595-1596	2
β-strand	1604	1	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Laminin subunit alpha-1	A	protein	633	Mus musculus	P19137
Laminin subunit beta-1	B	protein	56	Mus musculus	P02469 (AlphaFold model)
Laminin subunit gamma-1	C	protein	64	Mus musculus	P02468 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5MC9_1 Laminin subunit alpha-1 (chains A)
APLAMKDMEMQANLLLDRLKPLKTLEENLSRNLSEIKLLISRARKQAASIKVAVSADRDC
IRAYQPQTSSTNYNTLILNVKTQEPDNLLFYLGSSSSSDFLAVEMRRGKVAFLWDLGSGS
TRLEFPEVSINNNRWHSIYITRFGNMGSLSVKEASAAENPPVRTSKSPGPSKVLDINNST
LMFVGGLGGQIKKSPAVKVTHFKGCMGEAFLNGKSIGLWNYIEREGKCNGCFGSSQNEDS
SFHFDGSGYAMVEKTLRPTVTQIVILFSTFSPNGLLFYLASNGTKDFLSIELVRGRVKVM
VDLGSGPLTLMTDRRYNNGTWYKIAFQRNRKQGLLAVFDAYDTSDKETKQGETPGAASDL
NRLEKDLIYVGGLPHSKAVRKGVSSRSYVGCIKNLEISRSTFDLLRNSYGVRKGCALEPI
QSVSFLRGGYVEMPPKSLSPESSLLATFATKNSSGILLVALGKDAEEAGGAQAHVPFFSI
MLLEGRIEVHVNSGDGTSLRKALLHAPTGSYSDGQEHSISLVRNRRVITIQVDENSPVEM
KLGPLTEGKTIDISNLYIGGLPEDKATPMLKMRTSFHGCIKNVVLDAQLLDFTHATGSEQ
VELDTCLLAEEPMQSLHREHGELPPEPPTLPQP

Sequence of entity 2 (B), FASTA

>5MC9_2 Laminin subunit beta-1 (chains B)
GALASKLQLLEDLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISEKVAVYSTCL

Sequence of entity 3 (C), FASTA

>5MC9_3 Laminin subunit gamma-1 (chains C)
APLAKASDLDRKVSDLESEARKQEAAIMDYNRDIAEIIKDIHNLEDIKKTLPTGCFNTPS
IEKP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2

Primary citation

Crystal Structure of the Heterotrimeric Integrin-Binding Region of Laminin-111. Pulido, D., Hussain, S.A., Hohenester, E. Structure (2017) 25:530-535. DOI 10.1016/j.str.2017.01.002 · PubMed

Other PDB entries of the same protein (UniProt P19137), best resolution first:

2JD4 1.9 Å, Mouse laminin alpha1 chain, domains LG4-5
8DMK 3.7 Å, Cryo-EM reveals the molecular basis of laminin polymerization and LN-lamininopathies

Browse structure collections

About this viewer

MolViewer shows 5MC9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.