5MG2: Second bromodomain of human TAF1

Crystal structure of the second bromodomain of human TAF1 in complex with BAY-299 chemical probe. Determined by X-ray diffraction at 1.75 Å resolution. Released 3 May 2017.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,302
Mol. weight: 16.5 kDa
Ligands: 7M8
Released: 3 May 2017

Explore 5MG2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MG2 contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	1500-1513	14
α-helix	1514-1519	6
α-helix	1526-1528	3
α-helix	1540-1543	4
α-helix	1550-1558	9
α-helix	1565-1583	19
α-helix	1588-1606	19
α-helix	1608-1634	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription initiation factor TFIID subunit 1	A	protein	137	Homo sapiens	P21675 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5MG2_1 Transcription initiation factor TFIID subunit 1 (chains A)
SMDDDQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKVIVNPMDLETIRKNIS
KHKYQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNVCYQTLTEYDEHLTQLEKDI
CTAKEAALEEAELESLD

Ligands and cofactors

ID	Name	Formula	Copies
7M8	6-(3-oxidanylpropyl)-2-(1,3,6-trimethyl-2-oxidanylidene-benzimidazol-5-yl)benzo…	C25 H23 N3 O4	1

Water and common crystallization additives (EDO) are not listed.

Primary citation

Benzoisoquinolinediones as Potent and Selective Inhibitors of BRPF2 and TAF1/TAF1L Bromodomains. Bouche, L., Christ, C.D., Siegel, S. et al. J Med Chem (2017) 60:4002-4022. DOI 10.1021/acs.jmedchem.7b00306 · PubMed

Other PDB entries of the same protein (UniProt P21675 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5I29 1.21 Å, TAF1(2) bound to a pyrrolopyridone compound
7LB1 1.35 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-585
4YYM 1.5 Å, Crystal structure of TAF1 BD2 Bromodomain bound to a butyryllysine peptide
5I1Q 1.5 Å, Second bromodomain of TAF1 bound to a pyrrolopyridone compound
7K27 1.5 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ATR…
7JJG 1.6 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K03 1.6 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ATR…
7T36 1.65 Å, Crystal structure of the tandem bromodomain (BD1 and BD2) of human TAF1 bound to ZS1-322
7JSP 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to ATR kinase…
7K3O 1.7 Å, Crystal structure of the unliganded second bromodomain (BD2) of human TAF1
7K42 1.7 Å, Crystal structure of the second bromodomain (BD2) of human TAF1 bound to dioxane
7LB2 1.7 Å, Crystal structure of the tandem bromodomain (BD1, BD2) of human TAF1 bound to ZS1-589

Browse structure collections

About this viewer

MolViewer shows 5MG2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.