Crystal structure of human SR protein kinase 1 (SRPK1) in complex with compound 1. Determined by X-ray diffraction at 1.75 Å resolution. Released 24 May 2017.
Explore 5MXX in 3D Show helices and sheets RCSB PDB PDBe
5MXX contains 26 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 59-61 | 3 | |
| β-strand | 75-76 | 2 | 1 |
| β-strand | 80-88 | 9 | 1 |
| β-strand | 92-99 | 8 | 1 |
| β-strand | 104-111 | 8 | 1 |
| α-helix | 115-133 | 19 | |
| α-helix | 139-143 | 5 | |
| β-strand | 144 | 1 | 2 |
| β-strand | 147-155 | 9 | 1 |
| β-strand | 158-166 | 9 | 1 |
| β-strand | 171 | 1 | 2 |
| α-helix | 172-178 | 7 | |
| α-helix | 186-201 | 16 | |
| α-helix | 202-207 | 6 | |
| β-strand | 210 | 1 | 3 |
| α-helix | 216-218 | 3 | |
| β-strand | 219-221 | 3 | 2 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-236 | 12 | |
| α-helix | 479-481 | 3 | |
| α-helix | 485-490 | 6 | |
| β-strand | 493-495 | 3 | 2 |
| α-helix | 498-500 | 3 | |
| β-strand | 502 | 1 | 3 |
| β-strand | 503 | 1 | 4 |
| β-strand | 507 | 1 | 4 |
| α-helix | 515-517 | 3 | |
| α-helix | 520-523 | 4 | |
| α-helix | 531-546 | 16 | |
| α-helix | 561-573 | 13 | |
| α-helix | 576-577 | 2 | |
| α-helix | 578-583 | 6 | |
| α-helix | 587-590 | 4 | |
| β-strand | 591 | 1 | 5 |
| β-strand | 597 | 1 | 5 |
| α-helix | 608-614 | 7 | |
| α-helix | 620-630 | 11 | |
| α-helix | 631-634 | 4 | |
| α-helix | 638-640 | 3 | |
| α-helix | 642-643 | 2 | |
| α-helix | 644-648 | 5 | |
| α-helix | 651-654 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SRPK1 | A | protein | 399 | Homo sapiens | Q96SB4 (AlphaFold model) |
>5MXX_1 SRPK1 (chains A) SMPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWD IQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGT HICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRITHTDIKPENI LLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPATAGNFLVNPLEPKNAEKLKVKIA DLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSG EEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKY EWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 4 |
| W4A | 5-methyl-~{N}-[2-(4-methylpiperazin-1-yl)-5-(trifluoromethyl)phenyl]furan-2-car… | C18 H20 F3 N3 O2 | 1 |
Water and common crystallization additives (TRS, EDO) are not listed.
Development of Potent, Selective SRPK1 Inhibitors as Potential Topical Therapeutics for Neovascular Eye Disease. Batson, J., Toop, H.D., Redondo, C. et al. ACS Chem Biol (2017) 12:825-832. DOI 10.1021/acschembio.6b01048 · PubMed
Other PDB entries of the same protein (UniProt Q96SB4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5MXX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.