5MZT: H235Q mutant of GLIC

X-ray structure of the H235Q mutant of GLIC in complex with bromoform. Determined by X-ray diffraction at 2.65 Å resolution. Released 14 Feb 2018.

Method: X-ray diffraction
Resolution: 2.65 Å
Organism: Gloeobacter violaceus (strain PCC 7421)
Chains: 5
Atoms: 13,638
Mol. weight: 202.95 kDa
Ligands: PLC, LMT, MBR
Released: 14 Feb 2018

Explore 5MZT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5MZT contains 66 α-helices and 60 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	14-15	2
β-strand	16-31	16	1
β-strand	36-48	13	1
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	1
α-helix	68-70	3
β-strand	76-78	3	2
β-strand	81	1	1
β-strand	86-94	9	1
β-strand	99-111	13	1
β-strand	123-133	11	2
β-strand	140-144	5	1
α-helix	146-148	3
β-strand	150-151	2	1
β-strand	160-176	17	2
β-strand	179-192	14	2
α-helix	197	1
α-helix	198-202	5
α-helix	203-212	10
α-helix	213-217	5
α-helix	221-243	23
α-helix	254-281	28
α-helix	285-314	30

Chain D: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	14-15	2
β-strand	16-31	16	7
β-strand	36-48	13	7
α-helix	50-52	3
α-helix	56-59	4
β-strand	64-65	2	7
α-helix	68-70	3
β-strand	76-78	3	8
β-strand	81	1	7
β-strand	86-94	9	7
β-strand	99-111	13	7
β-strand	123-133	11	8
α-helix	134-135	2
β-strand	140-144	5	7
α-helix	146-148	3
β-strand	150-151	2	7
β-strand	160-176	17	8
β-strand	179-192	14	8
α-helix	197	1
α-helix	198-202	5
α-helix	203-212	10
α-helix	213-217	5
α-helix	221-243	23
α-helix	254-281	28
α-helix	285-314	30

Chain E: 13 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-10	5
α-helix	14-15	2
β-strand	16-31	16	9
β-strand	36-48	13	9
α-helix	50-52	3
β-strand	64-65	2	9
α-helix	68-70	3
β-strand	76-78	3	10
β-strand	81	1	9
β-strand	86-94	9	9
β-strand	99-111	13	9
β-strand	123-133	11	10
α-helix	134-135	2
β-strand	140-144	5	9
α-helix	146-148	3
β-strand	150-151	2	9
β-strand	160-176	17	10
β-strand	179-192	14	10
α-helix	197	1
α-helix	198-202	5
α-helix	203-212	10
α-helix	213-217	5
α-helix	221-243	23
α-helix	254-281	28
α-helix	285-314	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proton-gated ion channel	A, B, C, D, E	protein	327	Gloeobacter violaceus (strain PCC 7421)	Q7NDN8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>5MZT_1 Proton-gated ion channel (chains A, B, C, D, E)
GQDMVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSG
VRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYP
FDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRL
ESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAQIAFNI
LVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFP
VVFLLANIILAFLFFGFGYPYDVPDYA

Ligands and cofactors

ID	Name	Formula	Copies
PLC	Diundecyl phosphatidyl choline	C32 H65 N O8 P	15
LMT	Dodecyl-beta-D-maltoside	C24 H46 O11	6
MBR	Tribromomethane	C H Br3	10

Water and common crystallization additives (ACT, CL, NA) are not listed.

Primary citation

X-ray structure of the H235Q mutant of GLIC in complex with bromoform. Fourati, Z., Delarue, M. To be published.

Other PDB entries of the same protein (UniProt Q7NDN8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9LBD 2.14 Å, Cryo-EM structure of nanodisc (PE:PS:PC) reconstituted GLIC F116A mutant at pH 2.5
6HZW 2.22 Å, THE GLIC PENTAMERIC LIGAND-GATED ION CHANNEL 2.22 resolution
3IGQ 2.3 Å, Crystal structure of the extracellular domain of a bacterial pentameric ligand-gated ion…
6F0U 2.35 Å, GLIC mutant E35A
4HFI 2.4 Å, The GLIC pentameric Ligand-Gated Ion Channel at 2.4 A resolution
6F0R 2.5 Å, GLIC mutant E82Q
6F0Z 2.5 Å, GLIC mutant D88N
6HJZ 2.5 Å, Xray structure of GLIC in complex with succinate
6HZ1 2.5 Å, The glic pentameric ligand-gated ion channel mutant E243C
6HY5 2.58 Å, The glic pentameric ligand-gated ion channel mutant Q193C
3TLW 2.6 Å, The GLIC pentameric Ligand-Gated Ion Channel Loop2-21' oxidized mutant in a…
5IUX 2.6 Å, GLIC-V135C bimane labelled X-ray structure

Browse structure collections

About this viewer

MolViewer shows 5MZT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.