Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with Compound 2d. Determined by X-ray diffraction at 1.27 Å resolution. Released 7 Jun 2017.
Explore 5NK6 in 3D Show helices and sheets RCSB PDB PDBe
5NK6 contains 21 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 606 | 1 | |
| β-strand | 607 | 1 | 1 |
| α-helix | 608-609 | 2 | |
| α-helix | 610-612 | 3 | |
| β-strand | 613-622 | 10 | 1 |
| β-strand | 625-632 | 8 | 1 |
| β-strand | 641-648 | 8 | 1 |
| α-helix | 654-667 | 14 | |
| β-strand | 675 | 1 | 2 |
| α-helix | 676-677 | 2 | |
| β-strand | 678-682 | 5 | 1 |
| β-strand | 688-693 | 6 | 1 |
| β-strand | 699 | 1 | 2 |
| α-helix | 700-706 | 7 | |
| α-helix | 713-732 | 20 | |
| α-helix | 742-744 | 3 | |
| β-strand | 745-747 | 3 | 2 |
| β-strand | 753-755 | 3 | 2 |
| α-helix | 762-766 | 5 | |
| β-strand | 771 | 1 | 3 |
| β-strand | 779 | 1 | 3 |
| α-helix | 781-783 | 3 | |
| α-helix | 786-791 | 6 | |
| α-helix | 796-811 | 16 | |
| α-helix | 815-816 | 2 | |
| α-helix | 823-831 | 9 | |
| α-helix | 836-839 | 4 | |
| β-strand | 843 | 1 | 4 |
| α-helix | 844-853 | 10 | |
| α-helix | 858-860 | 3 | |
| α-helix | 862-863 | 2 | |
| α-helix | 864-876 | 13 | |
| α-helix | 878-882 | 5 | |
| β-strand | 884 | 1 | 4 |
| α-helix | 885-887 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ephrin type-A receptor 2 | A | protein | 306 | Homo sapiens | P29317 (AlphaFold model) |
>5NK6_1 Ephrin type-A receptor 2 (chains A) GDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTE KQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVL QLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTT SGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGF RLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIR LPSTSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| 90W | ~{N}-(2-chloranyl-6-methyl-phenyl)-2-[[3-[(4-oxidanylcyclohexyl)carbamoyl]pheny… | C24 H25 Cl N4 O3 S | 1 |
Chemoproteomics-Aided Medicinal Chemistry for the Discovery of EPHA2 Inhibitors. Heinzlmeir, S., Lohse, J., Treiber, T. et al. ChemMedChem (2017) 12:999-1011. DOI 10.1002/cmdc.201700217 · PubMed
Other PDB entries of the same protein (UniProt P29317 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NK6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.