KSHV uracil-DNA glycosylase, apo form. Determined by X-ray diffraction at 2.5 Å resolution. Released 21 Mar 2018.
Explore 5NN7 in 3D Show helices and sheets RCSB PDB PDBe
5NN7 contains 14 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 22-25 | 4 | |
| α-helix | 29-35 | 7 | |
| α-helix | 39-55 | 17 | |
| β-strand | 61-62 | 2 | 1 |
| α-helix | 65-67 | 3 | |
| α-helix | 71-74 | 4 | |
| α-helix | 77-79 | 3 | |
| β-strand | 82-86 | 5 | 2 |
| β-strand | 95 | 1 | 3 |
| β-strand | 102 | 1 | 3 |
| α-helix | 107-109 | 3 | |
| α-helix | 110-122 | 13 | |
| α-helix | 135-139 | 5 | |
| β-strand | 142-146 | 5 | 2 |
| β-strand | 151-152 | 2 | 1 |
| β-strand | 155 | 1 | 1 |
| α-helix | 162-178 | 17 | |
| β-strand | 183-187 | 5 | 2 |
| α-helix | 188-192 | 5 | |
| α-helix | 195-197 | 3 | |
| β-strand | 204-208 | 5 | 2 |
| β-strand | 218 | 1 | 4 |
| β-strand | 223 | 1 | 4 |
| α-helix | 232-242 | 11 | |
| α-helix | 246-248 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Uracil-DNA glycosylase | A | protein | 235 | Human herpesvirus 8 | F5HFA1 (AlphaFold model) |
>5NN7_1 Uracil-DNA glycosylase (chains A) DDRDLLLAPKWISFLSLSSFLKQKLLSLLRQIRELRLTTTVYPPQDKLMWWSHCCDPEDI KVVILGQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSHGCLDSWARQ GVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSKLEHCVFLLWGRKAIDRTPLINA QKHLVLTAQHPSPLASLGGRHSRWPRFQGCNHFNLANDYLTRHRRETVDWGLLEQ
A structurally conserved motif in gamma-herpesvirus uracil-DNA glycosylases elicits duplex nucleotide-flipping. Earl, C., Bagneris, C., Zeman, K. et al. Nucleic Acids Res (2018) 46:4286-4300. DOI 10.1093/nar/gky217 · PubMed
Other PDB entries of the same protein (UniProt F5HFA1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5NN7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.