5NOJ: Actin, alpha skeletal muscle

Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "OPEN" state. Determined by electron microscopy at 11.0 Å resolution. Released 2 Aug 2017.

Method: Electron microscopy
Resolution: 11.0 Å
Organism: Sus scrofa
Chains: 7
Atoms: 15,807
Mol. weight: 229.53 kDa
Ligands: MG, ADP
Released: 2 Aug 2017

Explore 5NOJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NOJ contains 108 α-helices and 95 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 21 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	17-21	5	1
β-strand	29-31	3	1
β-strand	35-36	2	2
β-strand	37-38	2	3
β-strand	53-54	2	2
α-helix	56-60	5
β-strand	65-66	2	3
α-helix	67	1
β-strand	71-72	2	4
β-strand	75-76	2	4
α-helix	79-91	13
α-helix	98-100	3
β-strand	103-107	5	1
α-helix	113-125	13
β-strand	131-136	6	1
α-helix	137-145	9
β-strand	150-155	6	5
β-strand	160-165	6	5
α-helix	172-174	3
β-strand	176-178	3	5
α-helix	182-193	12
α-helix	194-196	3
α-helix	203-215	13
α-helix	223-231	9
β-strand	238-241	4	6
β-strand	247-250	4	6
α-helix	253-256	4
α-helix	258-261	4
α-helix	264-266	3
α-helix	272-273	2
α-helix	274-284	11
α-helix	290-296	7
β-strand	297-300	4	5
α-helix	302-304	3
α-helix	309-320	12
β-strand	329-330	2	5
α-helix	335-348	14
β-strand	357-358	2	1
α-helix	359-370	12

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	99-232	134

Chain H: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	99-103	5
α-helix	110-232	123

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin, alpha skeletal muscle	A, B, C, D, E	protein	367	Sus scrofa	P68137 (AlphaFold model)
cardiac alpha tropomyosin	F, H	protein	136	Sus scrofa

Sequence of entity 1 (A, B, C, D, E), FASTA

>5NOJ_1 Actin, alpha skeletal muscle (chains A, B, C, D, E)
TTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGI
LTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMF
ETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRD
LTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPD
GQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTT
MYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE
AGPSIVH

Sequence of entity 2 (F, H), FASTA

>5NOJ_2 cardiac alpha tropomyosin (chains F, H)
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	5
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	5

Primary citation

Ca(2+)-induced movement of tropomyosin on native cardiac thin filaments revealed by cryoelectron microscopy. Risi, C., Eisner, J., Belknap, B. et al. Proc Natl Acad Sci U S A (2017) 114:6782-6787. DOI 10.1073/pnas.1700868114 · PubMed

Other PDB entries of the same protein (UniProt P68137 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CBW 2.5 Å, Crystal structure of Plasmodium berghei actin I with D-loop from muscle actin
8EFH 3.3 Å, Helical reconstruction of the human cardiac actin-tropomyosin-myosin complex in complex…
8DD0 3.5 Å, The structure of the native cardiac thin filament junction region
7KO5 7.8 Å, Structure of cardiac native thin filament at pCa=5.8 having upper and lower troponins in…
7KOR 7.8 Å, Structure of cardiac native thin filament at pCa=5.8 having upper troponin in Ca2+ bound…
5NOL 8.0 Å, Ca2+-induced Movement of Tropomyosin on Native Cardiac Thin Filaments - "Closed" state
7KO4 8.0 Å, Structure of cardiac native thin filament at pCa=5.8 having upper and lower troponins in…
7TIJ 8.0 Å, Cardiac F-actin decorated with regulatory M-domain of cardiac myosin binding protein C
7TIT 8.0 Å, Cardiac thin filament decorated with regulatory M-domain of cardiac myosin binding…
7TJ7 8.0 Å, Cardiac thin filament decorated with C1 Ig-domain and regulatory M-domain of cardiac…
7KON 8.1 Å, Structure of upper Tn Ca2+ free (rotated) and lower Tn Ca2+ bound cardiac native thin…
7KO7 8.3 Å, Structure of the native cardiac thin filament at pCa=5.8 having upper Tn in Ca2+ free…

Browse structure collections

About this viewer

MolViewer shows 5NOJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.