5NTN: Nuclear receptor ROR-gamma
Structural states of RORgt: X-ray elucidation of molecular mechanisms and binding interactions for natural and synthetic compounds. Determined by X-ray diffraction at 1.9 Å resolution. Released 21 Jun 2017.
- Method
- X-ray diffraction
- Resolution
- 1.9 Å
- Organism
- Homo sapiens
- Chains
- 8
- Atoms
- 9,068
- Mol. weight
- 130.05 kDa
- Ligands
- 98H
- Released
- 21 Jun 2017
Explore 5NTN in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
5NTN contains 68 α-helices and 16 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 16 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 267-284 | 18 | |
| α-helix | 289-294 | 6 | |
| α-helix | 295-297 | 3 | |
| β-strand | 299 | 1 | 1 |
| α-helix | 302-309 | 8 | |
| α-helix | 313-337 | 25 | |
| α-helix | 346-364 | 19 | |
| α-helix | 365-368 | 4 | |
| β-strand | 369-370 | 2 | 1 |
| β-strand | 375-378 | 4 | 1 |
| β-strand | 381-383 | 3 | 1 |
| α-helix | 385-391 | 7 | |
| α-helix | 394-408 | 15 | |
| α-helix | 414-425 | 12 | |
| α-helix | 436-456 | 21 | |
| α-helix | 460-465 | 6 | |
| α-helix | 467-468 | 2 | |
| α-helix | 469-489 | 21 | |
| α-helix | 491-497 | 7 | |
| α-helix | 500-506 | 7 | |
Chain B: 16 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 267-284 | 18 | |
| α-helix | 289-294 | 6 | |
| β-strand | 299 | 1 | 2 |
| α-helix | 302-309 | 8 | |
| α-helix | 313-337 | 25 | |
| α-helix | 341-343 | 3 | |
| α-helix | 346-364 | 19 | |
| α-helix | 365-368 | 4 | |
| β-strand | 369-370 | 2 | 2 |
| β-strand | 375-378 | 4 | 2 |
| β-strand | 381-383 | 3 | 2 |
| α-helix | 385-391 | 7 | |
| α-helix | 394-408 | 15 | |
| α-helix | 414-425 | 12 | |
| α-helix | 436-456 | 21 | |
| α-helix | 460-465 | 6 | |
| α-helix | 467-468 | 2 | |
| α-helix | 469-489 | 21 | |
| α-helix | 491-497 | 7 | |
| α-helix | 500-506 | 7 | |
Chain C: 15 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 267-284 | 18 | |
| α-helix | 289-294 | 6 | |
| β-strand | 299 | 1 | 3 |
| α-helix | 302-310 | 9 | |
| α-helix | 313-336 | 24 | |
| α-helix | 346-364 | 19 | |
| α-helix | 365-368 | 4 | |
| β-strand | 369-370 | 2 | 3 |
| β-strand | 375-378 | 4 | 3 |
| β-strand | 381-383 | 3 | 3 |
| α-helix | 385-391 | 7 | |
| α-helix | 394-408 | 15 | |
| α-helix | 414-425 | 12 | |
| α-helix | 436-455 | 20 | |
| α-helix | 460-463 | 4 | |
| α-helix | 467-468 | 2 | |
| α-helix | 469-489 | 21 | |
| α-helix | 491-497 | 7 | |
| α-helix | 500-506 | 7 | |
Chain D: 17 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 267-284 | 18 | |
| α-helix | 289-294 | 6 | |
| α-helix | 295-297 | 3 | |
| β-strand | 299 | 1 | 4 |
| α-helix | 302-310 | 9 | |
| α-helix | 313-337 | 25 | |
| α-helix | 339-342 | 4 | |
| α-helix | 346-364 | 19 | |
| α-helix | 365-368 | 4 | |
| β-strand | 369-370 | 2 | 4 |
| β-strand | 375-378 | 4 | 4 |
| β-strand | 381-383 | 3 | 4 |
| α-helix | 385-391 | 7 | |
| α-helix | 394-408 | 15 | |
| α-helix | 414-425 | 12 | |
| α-helix | 436-455 | 20 | |
| α-helix | 460-463 | 4 | |
| α-helix | 467-468 | 2 | |
| α-helix | 469-489 | 21 | |
| α-helix | 491-497 | 7 | |
| α-helix | 500-506 | 7 | |
Chains P, Q and S: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 500-505 | 6 | |
Chain R: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 500-504 | 5 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Nuclear receptor ROR-gamma | A, B, C, D | protein | 257 | Homo sapiens | P51449 (AlphaFold model) |
| Nuclear receptor-interacting protein 1 | P, Q, R, S | protein | 20 | Homo sapiens | P48552 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>5NTN_1 Nuclear receptor ROR-gamma (chains A, B, C, D)
GPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCA
HHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGK
YGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQ
LQYNLELAFHHHLSKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPL
YKELFSTETESPVGLSK
Sequence of entity 2 (P, Q, R, S), FASTA
>5NTN_2 Nuclear receptor-interacting protein 1 (chains P, Q, R, S)
NSHQKVTLLQLLLGHKNEEN
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| 98H | (5R,10S,13R,14R,17R)-17-((R,E)-7-hydroxy-6-methylhept-5-en-2-yl)-4,4,10,13,14-p… | C30 H46 O3 | 4 |
Primary citation
Structural States of ROR gamma t: X-ray Elucidation of Molecular Mechanisms and Binding Interactions for Natural and Synthetic Compounds. Kallen, J., Izaac, A., Be, C. et al. ChemMedChem (2017) 12:1014-1021. DOI 10.1002/cmdc.201700278 · PubMed
Other PDB entries of the same protein (UniProt P51449 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7NPC 1.47 Å, ROR(gamma)t ligand binding domain in complex with allosteric ligand FM156
- 6T4X 1.48 Å, ROR(gamma)t ligand binding domain in complex with 25-hydroxycholesterol and allosteric…
- 5APH 1.54 Å, Ligand complex of RORg LBD
- 6R7K 1.54 Å, Ligand complex of RORg LBD
- 7NP5 1.55 Å, ROR(gamma)t ligand binding domain in complex with allosteric ligand FM216
- 6W9I 1.61 Å, Substituted benzyloxytricyclic compounds as retinoic acid-related orphan receptor gamma…
- 6SAL 1.61 Å, ROR(gamma)t ligand binding domain in complex with allosteric ligand FM26
- 7OFK 1.61 Å, Ligand complex of RORg LBD
- 6T4T 1.62 Å, ROR(gamma)t ligand binding domain in complex with 20-alpha-hydroxycholesterol and…
- 7KXD 1.62 Å, Crystal structure of rar-related orphan receptor C (nhis-RORGT(244-487)-L6-SRC1(678-692))…
- 9N9L 1.64 Å, An RORgt Inverse agonist for treatment of Psoriasis
- 5NTW 1.64 Å, Structural states of RORgt: X-ray elucidation of molecular mechanisms and binding…
Browse structure collections
About this viewer
MolViewer shows 5NTN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.