5NTU: Human Pro-myostatin Precursor

Crystal Structure of human Pro-myostatin Precursor at 2.6 A Resolution. Determined by X-ray diffraction at 2.58 Å resolution. Released 17 Jan 2018.

Method: X-ray diffraction
Resolution: 2.58 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,520
Mol. weight: 77.14 kDa
Released: 17 Jan 2018

Explore 5NTU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NTU contains 16 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	47-63	17
α-helix	74-80	7
α-helix	85-92	8
α-helix	113	1
β-strand	114-120	7	1
α-helix	121-123	3
β-strand	139-140	2	2
α-helix	148-150	3
β-strand	151-160	10	1
α-helix	161-163	3
β-strand	167-176	10	2
β-strand	186-196	11	2
β-strand	202-207	6	1
α-helix	209-216	8
β-strand	223-230	8	2
β-strand	236	1	2
β-strand	238	1	1
β-strand	252-257	6	1
β-strand	280	1	3
β-strand	282-284	3	4
β-strand	287-289	3	5
α-helix	290-293	4
β-strand	298-300	3	6
β-strand	303-305	3	5
β-strand	308-310	3	4
β-strand	312	1	3
β-strand	315-319	5	7
β-strand	325-329	5	7
β-strand	340-353	14	6
β-strand	358-374	17	6

Chain B: 7 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	44-63	20
α-helix	74-80	7
α-helix	85-92	8
β-strand	114-120	7	6
α-helix	121-123	3
β-strand	151-160	10	6
α-helix	161-163	3
β-strand	167-176	10	8
β-strand	186-196	11	8
β-strand	202-207	6	6
α-helix	209-216	8
β-strand	225-230	6	8
β-strand	236	1	8
β-strand	238	1	6
β-strand	252-257	6	6
β-strand	271	1	9
β-strand	280	1	10
β-strand	282-284	3	9
β-strand	287-289	3	11
α-helix	290-293	4
β-strand	298-300	3	1
β-strand	303-305	3	11
β-strand	308-310	3	9
β-strand	312	1	10
β-strand	340-353	14	1
β-strand	358-374	17	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Growth/differentiation factor 8	A, B	protein	335	Homo sapiens	O14793 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5NTU_1 Growth/differentiation factor 8 (chains A, B)
GSTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDD
SSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYL
RPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLAAPA
SNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESR
CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLAAYPHTHLVHQANPRGSAGPCC
TPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Primary citation

Structure of the human myostatin precursor and determinants of growth factor latency. Cotton, T.R., Fischer, G., Wang, X. et al. EMBO J (2018) 37:367-383. DOI 10.15252/embj.201797883 · PubMed

Other PDB entries of the same protein (UniProt O14793 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5F3B 1.76 Å, Structure of myostatin in complex with chimeric RK35 antibody
5F3H 2.7 Å, Structure of myostatin in complex with humanized RK35 antibody
6UMX 2.79 Å, Structural basis for specific inhibition of extracellular activation of pro/latent…
5NXS 4.19 Å, Crystal Structure of Human Pro-myostatin Precursor at 4.2 A Resolution with Experimental…

Browse structure collections

About this viewer

MolViewer shows 5NTU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.