5O0Y: TLK2 kinase domain from human

TLK2 kinase domain from human. Determined by X-ray diffraction at 2.86 Å resolution. Released 30 May 2018.

Method: X-ray diffraction
Resolution: 2.86 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,390
Mol. weight: 67.92 kDa
Ligands: AGS
Released: 30 May 2018

Explore 5O0Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5O0Y contains 14 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	463-470	8	1
β-strand	474-481	8	1
β-strand	486-494	9	1
α-helix	502-519	18
β-strand	526	1	2
β-strand	529-534	6	1
β-strand	539-545	7	1
β-strand	550-551	2	2
α-helix	552-559	8
α-helix	564-581	18
β-strand	588-589	2	3
α-helix	595-597	3
β-strand	598-600	3	2
β-strand	609-611	3	2
α-helix	617	1
β-strand	618-619	2	3
β-strand	631-632	2	4
α-helix	641-643	3
α-helix	646-649	4
α-helix	655-656	2
β-strand	657-658	2	4
α-helix	661-676	16
α-helix	687-693	7
α-helix	712-721	10
α-helix	726-728	3
α-helix	732-735	4
α-helix	739-741	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serine/threonine-protein kinase tousled-like 2	A	protein	579	Homo sapiens	Q86UE8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5O0Y_1 Serine/threonine-protein kinase tousled-like 2 (chains A)
MGSSHHHHHHSTGSTEHSCSSQKQISIQHRQTQSDLTIEKISALENSKNSDLEKKEGRID
DLLRANCDLRRQIDEQQKMLEKYKERLNRCVTMSKKLLIEKSKQEKMACRDKSMQDRLRL
GHFTTVRHGASFTEQWTDGYAFQNLIKQQERINSQREEIERQRKMLAKRKPPAMGQAPPA
TNEQKQRKSKTNGAENETPSSGNTELKDTAPALGAHSLLRLTLAEYHEQEEIFKLRLGHL
KKEEAEIQAELERLERVRNLHIRELKRIHNEDNSQFKDHPTLNDRYLLLHLLGRGGFSEV
YKAFDLTEQRYVAVKIHQLNKNWRDEKKENYHKHACREYRIHKELDHPRIVKLYDYFSLD
TDSFCTVLEYCEGNDLDFYLKQHKLMSEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPG
NILLVNGTACGEIKITDFGLSKIMDDDSYNSVDGMELTSQGAGTYWYLPPECFVVGKEPP
KISNKVDVWSVGVIFYQCLYGRKPFGHNQSQQDILQENTILKATEVQFPPKPVVTPEAKA
FIRRCLAYRKEDRIDVQQLACDPYLLPHIRKSVSTSSPA

Ligands and cofactors

ID	Name	Formula	Copies
AGS	Phosphothiophosphoric acid-adenylate ester	C10 H16 N5 O12 P3 S	1

Primary citation

Molecular basis of Tousled-Like Kinase 2 activation. Mortuza, G.B., Hermida, D., Pedersen, A.K. et al. Nat Commun (2018) 9:2535-2535. DOI 10.1038/s41467-018-04941-y · PubMed

Other PDB entries of the same protein (UniProt Q86UE8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LO0 2.71 Å, Structure of human ASF1a in complex with a TLK2 peptide

Browse structure collections

About this viewer

MolViewer shows 5O0Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.