Ube4B U-box domain. Determined by X-ray diffraction at 1.48 Å resolution. Released 1 Nov 2017.
Explore 5O75 in 3D Show helices and sheets RCSB PDB PDBe
5O75 contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1101-1103 | 3 | |
| β-strand | 1104 | 1 | 1 |
| β-strand | 1111 | 1 | 1 |
| β-strand | 1115-1117 | 3 | 2 |
| β-strand | 1123-1125 | 3 | 2 |
| α-helix | 1126-1135 | 10 | |
| β-strand | 1138 | 1 | 3 |
| β-strand | 1145 | 1 | 3 |
| α-helix | 1148-1150 | 3 | |
| β-strand | 1152-1153 | 2 | 2 |
| α-helix | 1155-1165 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ubiquitin conjugation factor E4 B | A | protein | 78 | Homo sapiens | O95155 (AlphaFold model) |
>5O75_1 Ubiquitin conjugation factor E4 B (chains A) GSDAPDEFRDPLMDTLMTDPVRLPSGTIMDRSIILRHLLNSPTDPFNRQTLTESMLEPVP ELKEQIQAWMREKQNSDH
A General Strategy for Discovery of Inhibitors and Activators of RING and U-box E3 Ligases with Ubiquitin Variants. Gabrielsen, M., Buetow, L., Nakasone, M.A. et al. Mol Cell (2017) 68:456-470.e10. DOI 10.1016/j.molcel.2017.09.027 · PubMed
Other PDB entries of the same protein (UniProt O95155 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5O75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.