5OEC: Human Rab32 (18-201):GDP

Human Rab32 (18-201):GDP in complex with Salmonella GtgE (21-214) C45A mutant. Determined by X-ray diffraction at 2.3 Å resolution. Released 10 Jan 2018.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Salmonella choleraesuis, Homo sapiens
Chains: 2
Atoms: 2,920
Mol. weight: 44.01 kDa
Ligands: GDP, MG
Released: 10 Jan 2018

Explore 5OEC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OEC contains 14 α-helices and 19 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	25	1	1
β-strand	34	1	2
β-strand	41	1	2
α-helix	45-54	10
α-helix	64-67	4
β-strand	81-82	2	1
α-helix	83-92	10
β-strand	95-97	3	1
α-helix	98-99	2
α-helix	102-113	12
α-helix	118-135	18
β-strand	138-143	6	1
β-strand	150-159	10	1
β-strand	164-168	5	1
β-strand	176-179	4	1
α-helix	180-191	12
β-strand	204-208	5	1

Chain B: 7 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	23-32	10	3
α-helix	38-47	10
β-strand	57-58	2	1
β-strand	63-70	8	3
β-strand	73-81	9	3
α-helix	83-85	3
α-helix	93-96	4
β-strand	99-107	9	3
α-helix	111-115	5
α-helix	117-125	9
α-helix	134-137	4
β-strand	138-143	6	3
β-strand	169-171	3	3
β-strand	174	1	4
β-strand	179	1	4
α-helix	181-194	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
GtgE	A	protein	197	Salmonella choleraesuis	Q6EAT3 (AlphaFold model)
Ras-related protein Rab-32	B	protein	183	Homo sapiens	Q13637 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5OEC_1 GtgE (chains A)
GHMQGQIIHHRNFQSQFDTTGNTLYNNAWVCSLNVIKSRDGNNYSALEDITSDNQAFNNI
LEGIDIIECENLLKEMNVQKIPESSLFTNIKEALQAEVFNSTVEDDFESFISYELQNHGP
LMLIRPSLGSECLHAECIVGYDSEVKKVLIYDSMNTSPEWQSNIDVYDKLTLAFNDKYKN
EDCSICGLYYDGVYEPK

Sequence of entity 2 (B), FASTA

>5OEC_2 Ras-related protein Rab-32 (chains B)
METREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQ
LWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPA
VLLANKCDKNKDSSQSPSQVDQFDKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQS
FPN

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
MG	Magnesium ion	Mg	1

Primary citation

The protease GtgE from Salmonella exclusively targets inactive Rab GTPases. Wachtel, R., Brauning, B., Mader, S.L. et al. Nat Commun (2018) 9:44-44. DOI 10.1038/s41467-017-02110-1 · PubMed

Other PDB entries of the same protein (UniProt Q6EAT3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5OED 2.9 Å, Human Rab32:GDP in complex with Salmonella GtgE C45A mutant

Browse structure collections

About this viewer

MolViewer shows 5OEC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.