5OSC: GLIC-GABAAR alpha1 chimera crystallized

GLIC-GABAAR alpha1 chimera crystallized in complex with pregnenolone sulfate at pH 4.5. Determined by X-ray diffraction at 3.1 Å resolution. Released 11 Oct 2017.

Method: X-ray diffraction
Resolution: 3.1 Å
Organisms: Gloeobacter violaceus (strain PCC 7421), Mus musculus
Chains: 5
Atoms: 12,783
Mol. weight: 198.29 kDa
Ligands: A8W, Y01
Released: 11 Oct 2017

Explore 5OSC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5OSC contains 51 α-helices and 68 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
α-helix	14	1
β-strand	15-19	5	1
β-strand	20-30	11	2
β-strand	35-47	13	2
α-helix	49-51	3
β-strand	64	1	2
β-strand	75-77	3	3
β-strand	80	1	2
β-strand	85-93	9	2
β-strand	98-110	13	2
β-strand	122-132	11	3
β-strand	139-143	5	1
α-helix	145-147	3
β-strand	149-150	2	2
β-strand	156	1	3
β-strand	159-175	17	3
β-strand	178-191	14	3
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-241	11
α-helix	242-245	4
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-414	30

Chains B and D: 10 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	15-19	5	4
β-strand	20-30	11	5
β-strand	35-47	13	5
α-helix	49-51	3
β-strand	64	1	5
β-strand	75-77	3	6
β-strand	80	1	5
β-strand	85-93	9	5
β-strand	98-110	13	5
β-strand	122-132	11	6
β-strand	139-143	5	4
α-helix	145-147	3
β-strand	149-150	2	5
β-strand	159-175	17	6
β-strand	178-191	14	6
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-241	11
α-helix	242-245	4
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-414	30

Chains C and E: 10 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	6-9	4
β-strand	15-30	16	7
β-strand	35-47	13	7
α-helix	49-51	3
β-strand	64	1	7
β-strand	75-77	3	8
β-strand	80	1	7
β-strand	85-93	9	7
β-strand	98-110	13	7
β-strand	122-132	11	8
β-strand	139-143	5	7
α-helix	145-147	3
β-strand	149-150	2	7
β-strand	156	1	8
β-strand	159-166	8	8
β-strand	171-175	5	8
β-strand	178-191	14	8
α-helix	223-225	3
α-helix	226-230	5
α-helix	231-241	11
α-helix	242-245	4
α-helix	251-273	23
α-helix	284-308	25
α-helix	314-413	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proton-gated ion channel,Gamma-aminobutyric acid receptor subunit alpha-2,Gamma-aminobutyric acid…	A, B, C, D, E	protein	336	Gloeobacter violaceus (strain PCC 7421), Mus musculus	P26048 (AlphaFold model), P62812 (AlphaFold model), Q7NDN8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>5OSC_1 Proton-gated ion channel,Gamma-aminobutyric acid receptor subunit alpha-2,Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, B, C, D, E)
QDMVSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGV
RVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPF
DSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLE
SKLDYQLRISRQYGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFVVTTVLTMTTLS
ISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKSQPARAAKIDRLSRIAFP
LLFGIFNLVYWATYLNREPQLKAPTPHQHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A8W	Pregnenolone sulfate	C21 H32 O5 S	5
Y01	Cholesterol hemisuccinate	C31 H50 O4	5

Water and common crystallization additives (ACT, CL) are not listed.

Primary citation

Crystal structures of a GABAA-receptor chimera reveal new endogenous neurosteroid-binding sites. Laverty, D., Thomas, P., Field, M. et al. Nat Struct Mol Biol (2017) 24:977-985. DOI 10.1038/nsmb.3477 · PubMed

Browse structure collections

About this viewer

MolViewer shows 5OSC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.