PanDDA analysis group deposition -- Crystal Structure of ATAD2 in complex with DF826. Determined by X-ray diffraction at 1.41 Å resolution. Released 8 Apr 2020.
Explore 5QXN in 3D Show helices and sheets RCSB PDB PDBe
5QXN contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 980-1001 | 22 | |
| α-helix | 1004-1009 | 6 | |
| α-helix | 1021-1024 | 4 | |
| α-helix | 1031-1039 | 9 | |
| α-helix | 1046-1063 | 18 | |
| α-helix | 1069-1092 | 24 | |
| α-helix | 1095-1106 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ATPase family AAA domain-containing protein 2 | A | protein | 130 | Homo sapiens | Q6PL18 (AlphaFold model) |
>5QXN_1 ATPase family AAA domain-containing protein 2 (chains A) SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYRTVIKEPMDLSSVISKI DLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFE QLCEEIQESR
| ID | Name | Formula | Copies |
|---|---|---|---|
| RHG | (3aR,8S,9aS)-2-[(trifluoromethyl)sulfonyl]decahydro-3a,8-epoxypyrrolo[3,4-c]azo… | C10 H15 F3 N2 O3 S | 3 |
Water and common crystallization additives (EDO, SO4) are not listed.
PanDDA analysis group deposition - Bromodomain of human ATAD2 fragment screening. Snee, M., Talon, R., Fowley, D. et al. To be published.
Other PDB entries of the same protein (UniProt Q6PL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5QXN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.