XChem fragment screen -- CRYSTAL STRUCTURE OF THE BROMODOMAIN OF THE HUMAN ATAD2 in complex with N13501a. Determined by X-ray diffraction at 1.47 Å resolution. Released 13 May 2020.
Explore 5R4W in 3D Show helices and sheets RCSB PDB PDBe
5R4W contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 980-1001 | 22 | |
| α-helix | 1004-1009 | 6 | |
| α-helix | 1021-1024 | 4 | |
| α-helix | 1031-1039 | 9 | |
| α-helix | 1046-1063 | 18 | |
| α-helix | 1069-1092 | 24 | |
| α-helix | 1095-1106 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| ATPase family AAA domain-containing protein 2 | A | protein | 130 | Homo sapiens | Q6PL18 (AlphaFold model) |
>5R4W_1 ATPase family AAA domain-containing protein 2 (chains A) SMQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPDYRTVIKEPMDLSSVISKI DLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACALRDTAYAIIKEELDEDFE QLCEEIQESR
| ID | Name | Formula | Copies |
|---|---|---|---|
| RWP | methyl 4-[(trifluoroacetyl)amino]benzoate | C10 H8 F3 N O3 | 1 |
Water and common crystallization additives (SO4, EDO) are not listed.
XChem fragment screen. Talon, R., Krojer, T., Fairhead, M. et al. To be published.
Other PDB entries of the same protein (UniProt Q6PL18 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5R4W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.