5SVX: MORC3 CW

MORC3 CW in complex with histone H3K4me3. Determined by X-ray diffraction at 1.56 Å resolution. Released 5 Oct 2016.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: Homo sapiens
Chains: 2
Atoms: 600
Mol. weight: 7.21 kDa
Ligands: ZN
Released: 5 Oct 2016

Explore 5SVX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5SVX contains 4 α-helices and 3 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1	1
β-strand	2-6	5	1
β-strand	13-15	3	1
α-helix	29-31	3
α-helix	35-37	3
α-helix	43-47	5

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	3-6	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
MORC family CW-type zinc finger protein 3	A	protein	49	Homo sapiens	Q14149 (AlphaFold model)
H3K4me3	B	protein	11	Homo sapiens	P68431 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5SVX_1 MORC family CW-type zinc finger protein 3 (chains A)
SDQTWVQCDACLKWRKLPDGMDQLPEKWYCSNNPDPQFRNCEVPEEPED

Sequence of entity 2 (B), FASTA

>5SVX_2 H3K4me3 (chains B)
ARTKQTARKST

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Multivalent Chromatin Engagement and Inter-domain Crosstalk Regulate MORC3 ATPase. Andrews, F.H., Tong, Q., Sullivan, K.D. et al. Cell Rep (2016) 16:3195-3207. DOI 10.1016/j.celrep.2016.08.050 · PubMed

Other PDB entries of the same protein (UniProt Q14149 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5SVY 1.05 Å, MORC3 CW in complex with histone H3K4me1
6O5W 1.41 Å, Crystal structure of MORC3 CW domain fused with viral influenza A NS1 peptide
5SVI 1.61 Å, MORC3 CW domain in complex with unmodified histone H3
4QQ4 1.75 Å, CW-type zinc finger of MORC3 in complex with the amino terminus of histone H3
6O1E 2.41 Å, The crystal structure of human MORC3 ATPase-CW in complex with AMPPNP

Browse structure collections

About this viewer

MolViewer shows 5SVX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.