5SZJ: Human Rab10

Structure of human Rab10 in complex with the bMERB domain of Mical-cL. Determined by X-ray diffraction at 2.66 Å resolution. Released 24 Aug 2016.

Method: X-ray diffraction
Resolution: 2.66 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,638
Mol. weight: 41.89 kDa
Ligands: GNP, MG
Released: 24 Aug 2016

Explore 5SZJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5SZJ contains 14 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	8-15	8	1
α-helix	22-31	10
β-strand	44-53	10	1
β-strand	56-65	10	1
α-helix	72-75	4
α-helix	76-78	3
β-strand	84-90	7	1
α-helix	94-98	5
α-helix	100-110	11
α-helix	115	1
β-strand	116-122	7	1
α-helix	127-129	3
α-helix	134-143	10
β-strand	147-150	4	1
β-strand	152	1	2
β-strand	157	1	2
α-helix	160-172	13

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	532-534	3
α-helix	535-572	38
α-helix	583-632	50
α-helix	635-637	3
α-helix	640-681	42

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-10	A	protein	202	Homo sapiens	P61026 (AlphaFold model)
MICAL C-terminal-like protein	B	protein	153	Homo sapiens	O94851 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5SZJ_1 Ras-related protein Rab-10 (chains A)
GHMAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKI
KLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERM
LLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKE
PNSENVDISSGGGVTGWKSKCC

Sequence of entity 2 (B), FASTA

>5SZJ_2 MICAL C-terminal-like protein (chains B)
GHMKQEELKRLYKAQAIQRQLEEVEERQRASEIQGVRLEKALRGEADSGTQDEAQLLQEW
FKLVLEKNKLMRYESELLIMAQELELEDHQSRLEQKLREKMLKEESQKDEKDLNEEQEVF
TELMQVIEQRDKLVDSLEEQRIREKAEDQHFES

Ligands and cofactors

ID	Name	Formula	Copies
GNP	Phosphoaminophosphonic acid-guanylate ester	C10 H17 N6 O13 P3	1
MG	Magnesium ion	Mg	1

Water and common crystallization additives (PEG) are not listed.

Primary citation

bMERB domains are bivalent Rab8 family effectors evolved by gene duplication. Rai, A., Oprisko, A., Campos, J. et al. Elife (2016) 5. DOI 10.7554/eLife.18675 · PubMed

Other PDB entries of the same protein (UniProt P61026 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9G0C 1.8 Å, Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex.
9G0D 2.05 Å, Structure of human Mical1 bMERB_V978A domain:Rab10 complex.
5LPN 2.8 Å, Structure of human Rab10 in complex with the bMERB domain of Mical-1

Browse structure collections

About this viewer

MolViewer shows 5SZJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.