Set3 PHD finger in complex with histone H3K4me2. Determined by X-ray diffraction at 1.42 Å resolution. Released 2 Nov 2016.
Explore 5TDR in 3D Show helices and sheets RCSB PDB PDBe
5TDR contains 3 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3 | 1 | 1 |
| β-strand | 15-18 | 4 | 1 |
| β-strand | 25-27 | 3 | 1 |
| α-helix | 28-31 | 4 | |
| α-helix | 36-38 | 3 | |
| α-helix | 55-68 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-5 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SET domain-containing protein 3 | A | protein | 70 | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) | P36124 (AlphaFold model) |
| Histone H3 | B | protein | 11 | Homo sapiens | P68431 (AlphaFold model) |
>5TDR_1 SET domain-containing protein 3 (chains A) MGIITCICDLNDDDGFTIQCDHCNRWQHAICYGIKDIGMAPDDYLCNSCDPREVDINLAR KIQQERINVK
>5TDR_2 Histone H3 (chains B) ARTKQTARKST
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (NA) are not listed.
Structural Insight into Recognition of Methylated Histone H3K4 by Set3. Gatchalian, J., Ali, M., Andrews, F.H. et al. J Mol Biol (2017) 429:2066-2074. DOI 10.1016/j.jmb.2016.09.020 · PubMed
Other PDB entries of the same protein (UniProt P36124 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TDR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.