Phospholipase C gamma-1 C-terminal SH2 domain, spacegroup P212121. Determined by X-ray diffraction at 1.7 Å resolution. Released 19 Apr 2017.
Explore 5TO4 in 3D Show helices and sheets RCSB PDB PDBe
5TO4 contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 662-665 | 4 | |
| β-strand | 669-670 | 2 | 1 |
| α-helix | 675-684 | 10 | |
| β-strand | 690-695 | 6 | 1 |
| β-strand | 701-708 | 8 | 1 |
| β-strand | 711-720 | 10 | 1 |
| β-strand | 723-726 | 4 | 1 |
| β-strand | 729-731 | 3 | 1 |
| α-helix | 734-743 | 10 | |
| β-strand | 747 | 1 | 2 |
| β-strand | 750 | 1 | 2 |
| β-strand | 754-755 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 | A | protein | 101 | Bos taurus | P08487 (AlphaFold model) |
>5TO4_1 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (chains A) GSHMHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQ QEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEE
Multimodal Recognition of Diverse Peptides by the C-Terminal SH2 Domain of Phospholipase C-gamma 1 Protein. McKercher, M.A., Guan, X., Tan, Z. et al. Biochemistry (2017) 56:2225-2237. DOI 10.1021/acs.biochem.7b00023 · PubMed
Other PDB entries of the same protein (UniProt P08487 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TO4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.