5TQ1: Phospholipase C gamma-1 C-terminal SH2 domain

Phospholipase C gamma-1 C-terminal SH2 domain bound to a phosphopeptide derived from the insulin receptor. Determined by X-ray diffraction at 1.49 Å resolution. Released 19 Apr 2017.

Method: X-ray diffraction
Resolution: 1.49 Å
Organisms: Bos taurus, Rattus norvegicus
Chains: 2
Atoms: 1,124
Mol. weight: 13.38 kDa
Released: 19 Apr 2017

Explore 5TQ1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TQ1 contains 4 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	662-665	4
β-strand	669	1	1
α-helix	675-684	10
β-strand	690-695	6	1
β-strand	701-708	8	1
β-strand	711-720	10	1
β-strand	723-726	4	1
β-strand	729-731	3	1
α-helix	734-743	10
β-strand	747	1	2
β-strand	750	1	2
β-strand	754-755	2	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	784-786	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1	A	protein	101	Bos taurus	P08487 (AlphaFold model)
Insulin receptor	B	protein	11	Rattus norvegicus	P15127 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TQ1_1 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 (chains A)
GSHMHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQ
QEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEE

Sequence of entity 2 (B), FASTA

>5TQ1_2 Insulin receptor (chains B)
PSSVYVPDEWE

Primary citation

Multimodal Recognition of Diverse Peptides by the C-Terminal SH2 Domain of Phospholipase C-gamma 1 Protein. McKercher, M.A., Guan, X., Tan, Z. et al. Biochemistry (2017) 56:2225-2237. DOI 10.1021/acs.biochem.7b00023 · PubMed

Other PDB entries of the same protein (UniProt P08487 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5TNW 1.4 Å, Phospholipase C gamma-1 C-terminal SH2 domain
5TO4 1.7 Å, Phospholipase C gamma-1 C-terminal SH2 domain, spacegroup P212121
5TQS 1.88 Å, Phospholipase C gamma-1 C-terminal SH2 domain bound to a phosphopeptide derived from the…
2FCI Structural basis for the requirement of two phosphotyrosines in signaling mediated by…
2PLD Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-GAMMA1…
2PLE Nuclear magnetic resonance structure of an SH2 domain of phospholipase C-GAMMA1…

Browse structure collections

About this viewer

MolViewer shows 5TQ1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.