5TOB: Protein-tyrosine kinase 2-beta

Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves Pyk2 potency. Determined by X-ray diffraction at 2.12 Å resolution. Released 29 Nov 2017.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,067
Mol. weight: 33.09 kDa
Ligands: YAM
Released: 29 Nov 2017

Explore 5TOB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TOB contains 17 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	422-424	3
β-strand	425-433	9	1
β-strand	438-444	7	1
β-strand	452-457	6	1
α-helix	467-480	14
β-strand	486	1	2
α-helix	487-488	2
β-strand	489-493	5	1
β-strand	499-503	5	1
β-strand	509	1	2
α-helix	510-516	7
α-helix	523-541	19
α-helix	552-554	3
β-strand	555-559	5	2
β-strand	562-565	4	2
α-helix	589-591	3
α-helix	594-599	6
α-helix	604-619	16
α-helix	623-624	2
α-helix	631-633	3
α-helix	634-639	6
α-helix	644-647	4
α-helix	652-661	10
α-helix	666-668	3
α-helix	670-671	2
α-helix	672-689	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein-tyrosine kinase 2-beta	A	protein	282	Homo sapiens	Q14289 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TOB_1 Protein-tyrosine kinase 2-beta (chains A)
GSMGGPQYGIAREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEK
FMSEAVIMKNLDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYS
LQICKAMAYLESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIK
WMSPESINFRRFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLC
PPVLYTLMTRCWDYDPSDRPRFTELVCSLSDVYQMEKDIAME

Ligands and cofactors

ID	Name	Formula	Copies
YAM	N-methyl-N-{3-[({2-[(2-oxo-2,3-dihydro-1H-indol-5-yl)amino]-5-(trifluoromethyl)…	C21 H20 F3 N7 O3 S	1

Primary citation

Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves Pyk2 potency. Farand, J., Mai, N., Chandrasekhar, J. et al. Bioorg Med Chem Lett (2016) 26:5926-5930. DOI 10.1016/j.bmcl.2016.10.092 · PubMed

Other PDB entries of the same protein (UniProt Q14289 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3CC6 1.6 Å, Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
3FZS 1.75 Å, Crystal Structure of PYK2 complexed with BIRB796
4XEK 1.79 Å, Pyk2-FAT domain in complex with leupaxin LD4 motif
8XOX 1.9 Å, The Crystal Structure of FAK2 from Biortus.
3FZT 1.95 Å, Crystal structure of PYK2 complexed with PF-4618433
5TO8 1.98 Å, Selectivity switch between FAK and Pyk2: Macrocyclization of FAK inhibitors improves…
4H1M 1.99 Å, Crystal structure of PYK2 with the indole 10c
3H3C 2.0 Å, Crystal structure of PYK2 in complex with Sulfoximine-substituted…
4H1J 2.0 Å, Crystal structure of PYK2 with the pyrazole 13a
8YGX 2.0 Å, Structure of the PYK2 from Biortus.
4XEV 2.01 Å, Fusion of Pyk2-FAT domain with Leupaxin LD1 motif, complexed with Leupaxin LD4 peptide
3FZP 2.1 Å, Crystal structure of PYK2 complexed with ATPgS

Browse structure collections

About this viewer

MolViewer shows 5TOB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.