5TOF: Polyubiquitin-B

Room temperature structure of ubiquitin variant u7ub25. Determined by X-ray diffraction at 1.12 Å resolution. Released 24 May 2017.

Method: X-ray diffraction
Resolution: 1.12 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,135
Mol. weight: 8.93 kDa
Released: 24 May 2017

Explore 5TOF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TOF contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	1-7	7	1
β-strand	12-17	6	1
β-strand	22	1	2
α-helix	23-34	12
α-helix	38-40	3
β-strand	42-45	4	1
β-strand	48-49	2	1
α-helix	50-51	2
β-strand	55	1	2
α-helix	61-62	2
β-strand	66-70	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Polyubiquitin-B	A	protein	78	Homo sapiens	P0CG47 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TOF_1 Polyubiquitin-B (chains A)
GSMQIFVKFRTGKTYTLEVEPSDTIENVKAKIQDKLGIPPDQQRLIFAGKQLEDGRTLSD
YNIQKESTLHGVRRLRGG

Primary citation

Flexibility and Design: Conformational Heterogeneity along the Evolutionary Trajectory of a Redesigned Ubiquitin. Biel, J.T., Thompson, M.C., Cunningham, C.N. et al. Structure (2017) 25:739-749.e3. DOI 10.1016/j.str.2017.03.009 · PubMed

Other PDB entries of the same protein (UniProt P0CG47 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NVG 1.07 Å, Thr12 Phosphorylated Ubiquitin
5TOG 1.08 Å, Room temperature structure of ubiquitin variant u7ub25.2540
4XOF 1.15 Å, Observing the overall rocking motion of a protein in a crystal - Orthorhombic Ubiquitin…
5GOD 1.15 Å, Lys27-linked di-ubiquitin
5GOB 1.15 Å, Lys6-linked di-ubiquitin
5W46 1.18 Å, Structure of S65D Phosphomimetic Ubiquitin Refined at 1.2 Angstroms Resolution
7S6O 1.25 Å, The crystal structure of Lys48-linked di-ubiquitin
8IC9 1.25 Å, Lys48-linked K48C-diubiquitin
5DK8 1.32 Å, Human ubiquitin in the P1 space group
7CAP 1.33 Å, Cyclic Lys48-linked triubiquitin
5V1Y 1.42 Å, Crystal structure of the ternary RPN13 PRU-RPN2 (940-953)-ubiquitin complex
5KYC 1.43 Å, Crystal structure of USP7 catalytic domain [V302K] mutant in complex with ubiquitin…

Browse structure collections

About this viewer

MolViewer shows 5TOF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.