Room temperature structure of ubiquitin variant u7ub25.2540. Determined by X-ray diffraction at 1.08 Å resolution. Released 24 May 2017.
Explore 5TOG in 3D Show helices and sheets RCSB PDB PDBe
5TOG contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 1-6 | 6 | 1 |
| β-strand | 12-17 | 6 | 1 |
| β-strand | 22 | 1 | 2 |
| α-helix | 23-34 | 12 | |
| α-helix | 38-40 | 3 | |
| β-strand | 41-45 | 5 | 1 |
| β-strand | 48-49 | 2 | 1 |
| β-strand | 55 | 1 | 2 |
| α-helix | 57-59 | 3 | |
| β-strand | 66-71 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Polyubiquitin-B | A | protein | 78 | Homo sapiens | P0CG47 (AlphaFold model) |
>5TOG_1 Polyubiquitin-B (chains A) GSMQIFVKFRTGKTYTLEVEPSDTIENVKAKIQDKLGIPPDQQWLIFAGKRLEDGRTLSD YNIQKESTLRGVRRLRGG
Flexibility and Design: Conformational Heterogeneity along the Evolutionary Trajectory of a Redesigned Ubiquitin. Biel, J.T., Thompson, M.C., Cunningham, C.N. et al. Structure (2017) 25:739-749.e3. DOI 10.1016/j.str.2017.03.009 · PubMed
Other PDB entries of the same protein (UniProt P0CG47 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5TOG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.