5TVC: PDB entry 5TVC

Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with (E,2S)-N-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine (TI-5312). Determined by X-ray diffraction at 1.93 Å resolution. Released 30 Nov 2016.

Method: X-ray diffraction
Resolution: 1.93 Å
Organisms: Aplysia californica, Homo sapiens
Chains: 5
Atoms: 8,471
Mol. weight: 133.46 kDa
Ligands: 7LB
Released: 30 Nov 2016

Explore 5TVC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TVC contains 19 α-helices and 85 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	-1-13	15
β-strand	24	1	1
β-strand	27	1	1
β-strand	29-44	16	2
β-strand	49-66	18	2
α-helix	69-71	3
β-strand	77-81	5	2
α-helix	82-84	3
β-strand	90-92	3	3
β-strand	95	1	2
α-helix	98-99	2
β-strand	100-101	2	2
β-strand	106-110	5	2
β-strand	112-117	6	2
β-strand	120-126	7	2
β-strand	138-146	9	3
β-strand	154-157	4	2
β-strand	162	1	3
β-strand	164	1	2
β-strand	174-187	14	3
β-strand	194-206	13	3
α-helix	207-209	3

Chain B: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
β-strand	24	1	4
β-strand	27	1	4
β-strand	29-44	16	5
β-strand	49-66	18	5
α-helix	69-72	4
β-strand	77-81	5	5
α-helix	82-84	3
β-strand	90-92	3	6
β-strand	95	1	5
β-strand	100-101	2	5
β-strand	106-110	5	5
β-strand	112-117	6	5
β-strand	120-126	7	5
β-strand	138-146	9	6
β-strand	154-157	4	5
β-strand	162	1	6
β-strand	164	1	5
β-strand	175-187	13	6
β-strand	194-205	12	6

Chain C: 3 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	-2-13	16
β-strand	24	1	7
β-strand	27	1	7
β-strand	29-44	16	8
β-strand	49-66	18	8
α-helix	69-72	4
β-strand	77-81	5	8
α-helix	82-84	3
β-strand	90-92	3	9
β-strand	95	1	8
β-strand	100-101	2	8
β-strand	106-110	5	8
β-strand	112-117	6	8
β-strand	120-126	7	8
β-strand	138-146	9	9
β-strand	154-157	4	8
β-strand	162	1	9
β-strand	164	1	8
β-strand	174-185	12	9
β-strand	196-206	11	9

Chain D: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	3-12	10
β-strand	24	1	10
β-strand	27	1	10
β-strand	29-44	16	11
β-strand	49-66	18	11
α-helix	69-72	4
β-strand	77-81	5	11
α-helix	82-84	3
β-strand	90-92	3	12
β-strand	95	1	11
α-helix	98-99	2
β-strand	100-101	2	11
β-strand	106-110	5	11
β-strand	112-117	6	11
β-strand	120-126	7	11
β-strand	138-146	9	12
β-strand	154-157	4	11
β-strand	162	1	12
β-strand	164	1	11
β-strand	175-187	13	12
β-strand	194-205	12	12

Chain E: 4 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	-4-13	18
β-strand	24	1	13
β-strand	27	1	13
β-strand	29-44	16	14
β-strand	49-61	13	14
α-helix	63-65	3
α-helix	69-71	3
β-strand	77-81	5	14
α-helix	82-84	3
β-strand	90-92	3	15
β-strand	95	1	14
β-strand	100-101	2	14
β-strand	106-110	5	14
β-strand	114-117	4	14
β-strand	120-126	7	14
β-strand	138-146	9	15
β-strand	154-158	5	14
β-strand	162	1	15
β-strand	164	1	14
β-strand	174-186	13	15
β-strand	195-206	12	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera	A, B, C, D, E	protein	230	Aplysia californica, Homo sapiens	P32297 (AlphaFold model), Q8WSF8 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E), FASTA

>5TVC_1 Soluble acetylcholine receptor,Neuronal acetylcholine receptor subunit alpha-3 chimera (chains A, B, C, D, E)
DYKDDDDKLHSQANLMRLKSDLFNRSPMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVD
LVYWEQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQIAVVTH
DGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEIDLKTDTDQVDLSSYYAS
SKYEILSATQYKHDIKYNCCEEIYPDVVLVVKFRERRAGNGFFRNLFDSR

Ligands and cofactors

ID	Name	Formula	Copies
7LB	(E,2S)-N-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine	C17 H20 N2 O	4

Water and common crystallization additives (1PE, SO4) are not listed.

Primary citation

Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica (Ac-AChBP) containing loop C from the human alpha 3 nicotinic acetylcholine receptor in complex with (E,2S)-N-methyl-5-(5-phenoxy-3-pyridyl)pent-4-en-2-amine (TI-5312). Bobango, J., Wu, J., Talley, I.T. et al. To be published.

Other PDB entries of the same protein (UniProt P32297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4ZK4 1.9 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
5SYO 2.0 Å, Crystal structure of a chimeric acetylcholine binding protein from Aplysia californica…
6PV7 3.34 Å, Human alpha3beta4 nicotinic acetylcholine receptor in complex with nicotine
6PV8 3.87 Å, Human alpha3beta4 nicotinic acetylcholine receptor in complex with AT-1001

Browse structure collections

About this viewer

MolViewer shows 5TVC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.