5UAZ: Yeast nucleoporin

Crystal structure of the yeast nucleoporin. Determined by X-ray diffraction at 1.75 Å resolution. Released 27 Dec 2017.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,652
Mol. weight: 24.96 kDa
Released: 27 Dec 2017

Explore 5UAZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UAZ contains 11 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	249-251	3
β-strand	252-256	5	1
α-helix	260-262	3
α-helix	263-271	9
β-strand	276	1	2
α-helix	281-283	3
β-strand	309-310	2	1
β-strand	313-317	5	1
β-strand	318	1	2
α-helix	321-328	8
β-strand	333-335	3	3
β-strand	338-340	3	3
β-strand	341-344	4	1
α-helix	347-352	6

Chain B: 5 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	248-251	4
β-strand	252-256	5	4
α-helix	260-262	3
α-helix	263-271	9
β-strand	276	1	5
β-strand	309-310	2	4
β-strand	313-317	5	4
β-strand	318	1	5
α-helix	321-328	8
β-strand	334-335	2	6
β-strand	338-339	2	6
β-strand	341-344	4	4
α-helix	347-352	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nucleoporin NUP53	A, B	protein	111	Saccharomyces cerevisiae	Q03790 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5UAZ_1 Nucleoporin NUP53 (chains A, B)
SMNWDDHAIIIFGYPETIANSIILHFANFGEILEDFRVIKDFKKLNSKNMSKSPSLTAQK
YPIYTGDGWVKLTYKSELSKSRALQENGIIMNGTLIGCVSYSPAALKQLAS

Primary citation

Crystal structure of the yeast nucleoporin. Blus, B.J., Blobel, G. To be published.

Other PDB entries of the same protein (UniProt Q03790 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3W3Y 2.8 Å, Crystal structure of Kap121p bound to Nup53p
8TJ5 6.6 Å, Inner spoke ring of the yeast NPC
7N85 7.6 Å, Inner ring spoke from the isolated yeast NPC
7N9F 37.0 Å, Structure of the in situ yeast NPC
8ZZA Integrative structure and functional anatomy of a single spoke of a nuclear pore complex
8ZZB Integrative structure and functional anatomy of three spokes of a nuclear pore complex
8ZZC Integrative structure and functional anatomy of eight spokes of a nuclear pore complex
9A1P Comprehensive structure and functional adaptations of the yeast nuclear pore complex

Browse structure collections

About this viewer

MolViewer shows 5UAZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.