5UBB: Alpha N-terminal protein methyltransferase 1B

Name: PDB 5UBB: Crystal structure of human alpha N-terminal protein methyltransferase 1B
Published: 2017-03-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Crystal structure of human alpha N-terminal protein methyltransferase 1B. Determined by X-ray diffraction at 2.0 Å resolution. Released 22 Mar 2017.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,780
Mol. weight: 25.4 kDa
Ligands: SAM
Released: 22 Mar 2017

Explore 5UBB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UBB contains 13 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	65-76	12
α-helix	83-87	5
α-helix	91-93	3
α-helix	94-106	13
β-strand	109	1	1
β-strand	115	1	1
β-strand	119-123	5	2
α-helix	129-130	2
α-helix	131-135	5
β-strand	141-146	6	2
α-helix	149-158	10
β-strand	169-171	3	2
α-helix	174-176	3
β-strand	184-190	7	2
α-helix	193-195	3
α-helix	198-210	13
β-strand	212-223	12	2
β-strand	225	1	3
β-strand	230-232	3	4
β-strand	237-239	3	4
β-strand	241	1	3
α-helix	242-251	10
β-strand	256-261	6	2
α-helix	262-263	2
α-helix	270-271	2
β-strand	272-277	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha N-terminal protein methyltransferase 1B	A	protein	222	Homo sapiens	Q5VVY1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5UBB_1 Alpha N-terminal protein methyltransferase 1B (chains A)
GTSQVINGEMQFYARAKLFYQEVPATEEGMMGNFIELSSPDIQASQKFLRKFVGGPGRAG
TDCALDCGSGIGRVSKHVLLPVFNSVELVDMMESFLLEAQNYLQVKGDKVESYHCYSLQE
FTPPFRRYDVIWIQWVSGHLTDKDLLAFLSRCRDGLKENGIIILKDNVAREGCILDLSDS
SVTRDMDILRSLIRKSGLVVLGQEKQDGFPEQCIPVWMFALH

Ligands and cofactors

ID	Name	Formula	Copies
SAM	S-adenosylmethionine	C15 H22 N6 O5 S	1

Water and common crystallization additives (UNX) are not listed.

Primary citation

An asparagine/glycine switch governs product specificity of human N-terminal methyltransferase NTMT2. Dong, C., Dong, G., Li, L. et al. Commun Biol (2018) 1:183-183. DOI 10.1038/s42003-018-0196-2 · PubMed

Other PDB entries of the same protein (UniProt Q5VVY1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DUB 1.2 Å, Crystal structure of a methyltransferase
6KDS 1.84 Å, Crystal structure of human NRMT2 in complex with alpha-N-monomethylated human CENP-A…
6KDR 2.11 Å, Crystal structure of human NRMT2 in complex with human centromere protein B peptide

Browse structure collections

About this viewer

MolViewer shows 5UBB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.