5UF7: MUNC13-1 mun domain

Crystal structure of MUNC13-1 mun domain. Determined by X-ray diffraction at 2.9 Å resolution. Released 15 Feb 2017.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 4,281
Mol. weight: 62.85 kDa
Released: 15 Feb 2017

Explore 5UF7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UF7 contains 31 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	944-961	18
α-helix	964-967	4
α-helix	973-995	23
α-helix	1005-1026	22
α-helix	1028-1035	8
α-helix	1059-1074	16
α-helix	1075-1079	5
α-helix	1080-1082	3
α-helix	1092-1116	25
α-helix	1123-1136	14
α-helix	1137-1141	5
α-helix	1151-1152	2
α-helix	1154-1187	34
α-helix	1200-1218	19
α-helix	1224-1256	33
α-helix	1263-1285	23
α-helix	1288-1290	3
α-helix	1293-1319	27
α-helix	1322-1337	16
α-helix	1350-1352	3
α-helix	1353-1367	15
α-helix	1368-1372	5
α-helix	1373-1375	3
α-helix	1376-1378	3
α-helix	1381-1401	21
α-helix	1406-1408	3
β-strand	1409-1411	3	1
β-strand	1416-1418	3	1
α-helix	1419-1421	3
α-helix	1423-1425	3
α-helix	1426-1444	19
α-helix	1452-1457	6
α-helix	1459-1471	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein unc-13 homolog A	A	protein	547	Rattus norvegicus	Q62768 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5UF7_1 Protein unc-13 homolog A (chains A)
GKERFVKLLDQLHNSLRIDLSMYRNNFPASSPERLQDLKSTVDLLTSITFFRMKVQELQS
PPRASQVVKDCVKACLNSTYEYIFNNCHELYGREYQTDPAKKGEVPPEEQGPSIKNLDFW
SKLITLIVSIIEEDKNSYTPCLNQFPQELNVGKISAEVMWSLFAQDMKYAMEEHDKHRLC
KSADYMNLHFKVKWLYNEYVAELPTFKDRVPEYPAWFEPFVIQWLDENEEVSRDFLHGAL
ERDKKDGFQQTSEHALFSCSVVDVFSQLNQSFEIIKKLECPDPQIVGHYMRRFAKTISNV
LLQYADIVSKDFASYCSKEKEKVPCILMNNTQQLRVQLEKMFEAMGGKELDAEASGTLKE
LQVKLNNVLDELSHVFATSFQPHIEECVRQMGDILSQVKGTGNVPASACSSVAQDADNVL
QPIMDLLDSNLTLFAKICEKTVLKRVLKELWKLVMNTMERTIVLPPEFSKLKDHMVREEA
KSLTPKQCAVVELALDTIKQYFHAGGVGLKKTFLEKSPDLQSLRYALSLYTQATDLLIKT
FVQTQSA

Primary citation

Mechanistic insights into neurotransmitter release and presynaptic plasticity from the crystal structure of Munc13-1 C1C2BMUN. Xu, J., Camacho, M., Xu, Y. et al. Elife (2017) 6. DOI 10.7554/eLife.22567 · PubMed

Other PDB entries of the same protein (UniProt Q62768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6NYT 1.37 Å, Munc13-1 C2B-domain, calcium bound
2CJT 1.44 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
2CJS 1.78 Å, Structural Basis for a Munc13-1 Homodimer - Munc13-1 - RIM Heterodimer Switch:…
6NYC 1.89 Å, Munc13-1 C2B-domain, calcium free
3SWH 2.65 Å, Munc13-1, MUN domain, C-terminal module
6A30 2.79 Å, Crystal Structure of Munc13-1 MUN Domain and Synaptobrevin-2 Juxtamembrane Linker Region
4Y21 2.9 Å, Crystal Structure of Munc13-1 MUN domain
5UE8 3.35 Å, The crystal structure of Munc13-1 C1C2BMUN domain
7T7X 10.0 Å, Munc13-1 C1-C2B-MUN-C2C Upright conformation spanning two lipid bilayers
7T81 10.0 Å, Model of Munc13-1 C1-C2B-MUN-C2C 2D crystal between lipid bilayers.
1Y8F Solution structure of the munc13-1 C1-domain
2KDU Structural basis of the Munc13-1/Ca2+-Calmodulin interaction: A novel 1-26 calmodulin…

Browse structure collections

About this viewer

MolViewer shows 5UF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.