Design, Synthesis, and Evaluation of the First Selective and Potent G-protein-Coupled Receptor Kinase 2 (GRK2) Inhibitor for the Potential Treatment of Heart Failure. Determined by X-ray diffraction at 2.7 Å resolution. Released 26 Jul 2017.
Explore 5UUU in 3D Show helices and sheets RCSB PDB PDBe
5UUU contains 28 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 34-36 | 3 | |
| α-helix | 37-39 | 3 | |
| α-helix | 40-49 | 10 | |
| α-helix | 55-60 | 6 | |
| α-helix | 62-72 | 11 | |
| α-helix | 157-161 | 5 | |
| α-helix | 162-167 | 6 | |
| α-helix | 169-182 | 14 | |
| α-helix | 188-190 | 3 | |
| β-strand | 191-199 | 9 | 1 |
| β-strand | 203-210 | 8 | 1 |
| β-strand | 216-223 | 8 | 1 |
| α-helix | 224-229 | 6 | |
| α-helix | 233-246 | 14 | |
| β-strand | 254 | 1 | 2 |
| β-strand | 257-262 | 6 | 1 |
| β-strand | 266-271 | 6 | 1 |
| β-strand | 278 | 1 | 2 |
| α-helix | 279-286 | 8 | |
| α-helix | 289-290 | 2 | |
| α-helix | 291-310 | 20 | |
| β-strand | 313-314 | 2 | 3 |
| α-helix | 320-322 | 3 | |
| β-strand | 323-325 | 3 | 2 |
| β-strand | 331-333 | 3 | 2 |
| β-strand | 340-341 | 2 | 3 |
| α-helix | 359-362 | 4 | |
| α-helix | 371-386 | 16 | |
| α-helix | 399-407 | 9 | |
| α-helix | 410-411 | 2 | |
| α-helix | 419-428 | 10 | |
| α-helix | 433-435 | 3 | |
| α-helix | 444-448 | 5 | |
| α-helix | 451-453 | 3 | |
| α-helix | 458-462 | 5 | |
| α-helix | 467-468 | 2 | |
| α-helix | 500-504 | 5 | |
| β-strand | 511-512 | 2 | 1 |
| α-helix | 514-524 | 11 | |
| α-helix | 526-537 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Beta-adrenergic receptor kinase 1 | A | protein | 547 | Homo sapiens | P25098 (AlphaFold model) |
>5UUU_1 Beta-adrenergic receptor kinase 1 (chains A) MSYYHHHHHHDYDIPTTENLYFQGAMEPGGSTPAARASKKILLPEPSIRSVMQKYLEDRG EVTFEKIFSQKLGYLLFRDFCLNHLEEARPLVEFYEEIKKYEKLETEEERVARSREIFDS YIMKELLACSHPFSKSATEHVQGHLGKKQVPPDLFQPYIEEICQNLRGDVFQKFIESDKF TRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYAMKCLDKKRIKMKQ GETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGDLHYHLSQHGVFSE ADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASV GTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKDKHEIDRMTLTMAV ELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDWQMVFLQKYPPPLI PPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINA ETDRLEA
| ID | Name | Formula | Copies |
|---|---|---|---|
| QRW | 3-({[4-methyl-5-(pyridin-4-yl)-4H-1,2,4-triazol-3-yl]methyl}amino)-N-[2-(triflu… | C24 H21 F3 N6 O | 1 |
Water and common crystallization additives (MES, SO4) are not listed.
Design, Synthesis, and Evaluation of the Highly Selective and Potent G-Protein-Coupled Receptor Kinase 2 (GRK2) Inhibitor for the Potential Treatment of Heart Failure. Okawa, T., Aramaki, Y., Yamamoto, M. et al. J Med Chem (2017) 60:6942-6990. DOI 10.1021/acs.jmedchem.7b00443 · PubMed
Other PDB entries of the same protein (UniProt P25098 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5UUU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.