5UW8: E. coli MCE protein MlaD, core MCE domain

Structure of E. coli MCE protein MlaD, core MCE domain. Determined by X-ray diffraction at 2.15 Å resolution. Released 12 Apr 2017.

Method: X-ray diffraction
Resolution: 2.15 Å
Organism: Escherichia coli O157:H7
Chains: 7
Atoms: 5,728
Mol. weight: 94.95 kDa
Released: 12 Apr 2017

Explore 5UW8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5UW8 contains 22 α-helices and 70 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	1
β-strand	57-60	4	1
β-strand	63-73	11	1
β-strand	80-87	8	1
β-strand	94	1	2
β-strand	98-103	6	1
β-strand	110-115	6	1
α-helix	116-118	3
β-strand	127	1	2
β-strand	133-134	2	1
β-strand	136-138	3	1

Chain B: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	3
β-strand	57-60	4	3
β-strand	63-73	11	3
β-strand	80-87	8	3
β-strand	94	1	4
β-strand	98-104	7	3
β-strand	109-115	7	3
α-helix	116-118	3
α-helix	126	1
β-strand	127	1	4
α-helix	128	1
β-strand	133-134	2	3
β-strand	136-138	3	3

Chain C: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	5
β-strand	57-60	4	5
β-strand	63-73	11	5
β-strand	80-87	8	5
β-strand	94	1	6
β-strand	98-103	6	5
β-strand	110-115	6	5
α-helix	116-118	3
α-helix	125-126	2
β-strand	127	1	6
α-helix	128	1
β-strand	132-134	3	5
β-strand	136-138	3	5

Chain D: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	7
β-strand	57-60	4	7
β-strand	63-73	11	7
β-strand	80-87	8	7
β-strand	94	1	8
β-strand	98-103	6	7
β-strand	110-115	6	7
α-helix	116-118	3
α-helix	125-126	2
β-strand	127	1	8
α-helix	128	1
β-strand	133-134	2	7
β-strand	136-138	3	7

Chain E: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	36-38	3
β-strand	39-45	7	9
β-strand	57-60	4	9
β-strand	63-73	11	9
β-strand	80-87	8	9
β-strand	94	1	10
β-strand	98-104	7	9
β-strand	109-115	7	9
α-helix	116-118	3
α-helix	125-126	2
β-strand	127	1	10
α-helix	128	1
β-strand	133-134	2	9
β-strand	136-138	3	9

Chain F: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	39-45	7	11
β-strand	57-60	4	11
β-strand	63-73	11	11
β-strand	80-87	8	11
β-strand	94	1	12
β-strand	98-104	7	11
β-strand	109-115	7	11
α-helix	116-118	3
α-helix	125-126	2
β-strand	127	1	12
α-helix	128	1
β-strand	132-134	3	11
β-strand	136-138	3	11

Chain G: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	36-38	3
β-strand	39-45	7	13
β-strand	57-60	4	13
β-strand	63-73	11	13
β-strand	80-87	8	13
β-strand	94	1	14
β-strand	98-103	6	13
β-strand	110-115	6	13
α-helix	116-118	3
α-helix	121-123	3
α-helix	126	1
β-strand	127	1	14
α-helix	128	1
β-strand	132-134	3	13
β-strand	136-138	3	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Probable phospholipid ABC transporter-binding protein MlaD	A, B, C, D, E, F, G	protein	122	Escherichia coli O157:H7	P64605 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G), FASTA

>5UW8_1 Probable phospholipid ABC transporter-binding protein MlaD (chains A, B, C, D, E, F, G)
MHHHHHHENLYFQTSIRTEPTYTLYATFDNIGGLKARSPVSIGGVVVGRVADITLDPKTY
LPRVTLEIEQRYNHIPDTSSLSIRTSGLLGEQYLALNVGFEDPELGTAILKDGDTIQDTK
SA

Primary citation

Architectures of Lipid Transport Systems for the Bacterial Outer Membrane. Ekiert, D.C., Bhabha, G., Isom, G.L. et al. Cell (2017) 169:273-285.e17. DOI 10.1016/j.cell.2017.03.019 · PubMed

Other PDB entries of the same protein (UniProt P64605 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5UW2 2.85 Å, Structure of E. coli MCE protein MlaD, periplasmic domain

Browse structure collections

About this viewer

MolViewer shows 5UW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.