2.9A XFEL structure of the multi-domain human smoothened receptor (with E194M mutation) in complex with TC114. Determined by X-ray diffraction at 2.9 Å resolution. Released 24 May 2017.
Explore 5V56 in 3D Show helices and sheets RCSB PDB PDBe
5V56 contains 60 α-helices and 54 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 65-67 | 3 | 1 |
| β-strand | 71-72 | 2 | 2 |
| β-strand | 77-78 | 2 | 3 |
| β-strand | 81-82 | 2 | 3 |
| β-strand | 87-88 | 2 | 2 |
| α-helix | 99-109 | 11 | |
| α-helix | 110-113 | 4 | |
| α-helix | 116-130 | 15 | |
| β-strand | 134 | 1 | 1 |
| β-strand | 138-140 | 3 | 1 |
| α-helix | 141-143 | 3 | |
| α-helix | 144-151 | 8 | |
| α-helix | 155-160 | 6 | |
| β-strand | 197-199 | 3 | 4 |
| α-helix | 203-205 | 3 | |
| β-strand | 207 | 1 | 5 |
| β-strand | 210 | 1 | 5 |
| β-strand | 213-215 | 3 | 4 |
| β-strand | 216 | 1 | 6 |
| α-helix | 224-253 | 30 | |
| α-helix | 256-259 | 4 | |
| α-helix | 262-282 | 21 | |
| α-helix | 283-285 | 3 | |
| α-helix | 289-294 | 6 | |
| β-strand | 295 | 1 | 7 |
| β-strand | 300 | 1 | 6 |
| β-strand | 301 | 1 | 7 |
| α-helix | 302 | 1 | |
| β-strand | 305 | 1 | 8 |
| α-helix | 313-343 | 31 | |
| α-helix | 357-378 | 22 | |
| β-strand | 381-383 | 3 | 8 |
| β-strand | 390-392 | 3 | 8 |
| α-helix | 397-400 | 4 | |
| α-helix | 401-405 | 5 | |
| α-helix | 406-431 | 26 | |
| β-strand | 1003-1009 | 7 | 9 |
| α-helix | 1014-1028 | 15 | |
| β-strand | 1032-1037 | 6 | 9 |
| α-helix | 1038-1040 | 3 | |
| β-strand | 1052-1057 | 6 | 9 |
| β-strand | 1059-1060 | 2 | 10 |
| β-strand | 1066-1067 | 2 | 10 |
| α-helix | 1072-1076 | 5 | |
| α-helix | 1078-1080 | 3 | |
| β-strand | 1087-1094 | 8 | 9 |
| α-helix | 1103-1115 | 13 | |
| β-strand | 1118-1119 | 2 | 9 |
| β-strand | 1124-1127 | 4 | 9 |
| α-helix | 1134-1146 | 13 | |
| α-helix | 447-491 | 45 | |
| α-helix | 515-533 | 19 | |
| α-helix | 534-536 | 3 | |
| α-helix | 539-552 | 14 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 65-67 | 3 | 11 |
| β-strand | 71-72 | 2 | 12 |
| β-strand | 77-78 | 2 | 13 |
| β-strand | 81-82 | 2 | 13 |
| β-strand | 87-88 | 2 | 12 |
| α-helix | 99-109 | 11 | |
| α-helix | 110-113 | 4 | |
| β-strand | 114 | 1 | 14 |
| α-helix | 116-130 | 15 | |
| β-strand | 134 | 1 | 11 |
| β-strand | 138-140 | 3 | 11 |
| α-helix | 141-143 | 3 | |
| α-helix | 144-151 | 8 | |
| α-helix | 155-160 | 6 | |
| α-helix | 181-183 | 3 | |
| β-strand | 192 | 1 | 14 |
| β-strand | 197-199 | 3 | 15 |
| α-helix | 203-205 | 3 | |
| β-strand | 207 | 1 | 16 |
| β-strand | 210 | 1 | 16 |
| β-strand | 213-215 | 3 | 15 |
| β-strand | 216 | 1 | 17 |
| α-helix | 224-254 | 31 | |
| α-helix | 256-259 | 4 | |
| α-helix | 262-282 | 21 | |
| α-helix | 283-285 | 3 | |
| α-helix | 289-294 | 6 | |
| β-strand | 295 | 1 | 18 |
| β-strand | 300 | 1 | 17 |
| β-strand | 301 | 1 | 18 |
| α-helix | 302 | 1 | |
| β-strand | 305 | 1 | 19 |
| α-helix | 313-344 | 32 | |
| α-helix | 345-347 | 3 | |
| α-helix | 357-378 | 22 | |
| β-strand | 381-383 | 3 | 19 |
| β-strand | 390-392 | 3 | 19 |
| α-helix | 397-400 | 4 | |
| α-helix | 401-405 | 5 | |
| α-helix | 406-429 | 24 | |
| α-helix | 430-432 | 3 | |
| β-strand | 1002-1009 | 8 | 20 |
| α-helix | 1014-1028 | 15 | |
| β-strand | 1031-1037 | 7 | 20 |
| α-helix | 1038-1040 | 3 | |
| β-strand | 1052-1057 | 6 | 20 |
| β-strand | 1059-1060 | 2 | 21 |
| β-strand | 1066-1067 | 2 | 21 |
| α-helix | 1072-1076 | 5 | |
| α-helix | 1078-1080 | 3 | |
| β-strand | 1087-1094 | 8 | 20 |
| α-helix | 1103-1115 | 13 | |
| β-strand | 1118-1119 | 2 | 20 |
| β-strand | 1124-1127 | 4 | 20 |
| α-helix | 1130-1133 | 4 | |
| α-helix | 1134-1146 | 13 | |
| α-helix | 447-492 | 46 | |
| α-helix | 515-533 | 19 | |
| α-helix | 534-536 | 3 | |
| α-helix | 539-552 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Smoothened homolog,Flavodoxin,Smoothened homolog | A, B | protein | 653 | Homo sapiens, Desulfovibrio vulgaris | P00323 (AlphaFold model), Q99835 (AlphaFold model) |
>5V56_1 Smoothened homolog,Flavodoxin,Smoothened homolog (chains A, B) AVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGL RNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPD RFPEGCTNEVQNIKFNSSGQCMVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHS YIAAFGAVTGLCTLFTLATFVADWRNSNRYPAVILFYVNACFFVGSIGWLAQFMDGARRE IVCRADGTMRLGEPTSNETLSCVIIFVIVYYALMAGVVWFVVLTYAWHTSFKALGTTYQP LSGKTSYFHLLTWSLPFVLTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVL IVGGYFLIRGVMTLFSIKSNHAKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAAS VEAGGLFEGFDLVLLGCSTWGDDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSWEY FCGAVDAIEEKLKNLGAEIVQDGLRIDGDPRAARDDIVGWAHDVRGAIKINETMLRLGIF GFLAFGFVLITFSCHFYDFFNQAEWERSFRDYVLCQANVTIGLPTKQPIPDCEIKNRPSL LVEKINLFAMFGTGIAMSTWVWTKATLLIWRRTWCRLTGQSDDHHHHHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 1 |
| FMN | Flavin mononucleotide | C17 H21 N4 O9 P | 2 |
| 836 | N-methyl-N-[1-[4-(2-methylpyrazol-3-yl)phthalazin-1-yl]piperidin-4-yl]-4-nitro-… | C26 H24 F3 N7 O3 | 2 |
Crystal structure of a multi-domain human smoothened receptor in complex with a super stabilizing ligand. Zhang, X., Zhao, F., Wu, Y. et al. Nat Commun (2017) 8:15383-15383. DOI 10.1038/ncomms15383 · PubMed
Other PDB entries of the same protein (UniProt P00323 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5V56 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.