Crystal structure of homo sapiens serine hydroxymethyltransferase 2 (mitochondrial) (SHMT2), in complex with glycine, PLP and folate-competitive pyrazolopyran inhibitor: 6-amino-4-isopropyl-3-methyl-4-(3-(pyrrolidin-1-yl)-5-(trifluoromethyl)phenyl)-1,4-dihydropyrano[2,3-c]pyrazole-5-carbonitrile. Determined by X-ray diffraction at 2.47 Å resolution. Released 11 Oct 2017.
Explore 5V7I in 3D Show helices and sheets RCSB PDB PDBe
5V7I contains 53 α-helices and 42 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 49-52 | 4 | |
| α-helix | 54-69 | 16 | |
| β-strand | 71-72 | 2 | 1 |
| α-helix | 82-88 | 7 | |
| α-helix | 91-94 | 4 | |
| β-strand | 99-100 | 2 | 2 |
| β-strand | 103-104 | 2 | 2 |
| α-helix | 110-126 | 17 | |
| β-strand | 134-137 | 4 | 3 |
| α-helix | 143-154 | 12 | |
| β-strand | 160-164 | 5 | 3 |
| α-helix | 172-174 | 3 | |
| β-strand | 177 | 1 | 4 |
| β-strand | 182 | 1 | 4 |
| α-helix | 185-189 | 5 | |
| β-strand | 191-195 | 5 | 3 |
| β-strand | 197-198 | 2 | 5 |
| β-strand | 203-204 | 2 | 5 |
| α-helix | 206-216 | 11 | |
| β-strand | 220-223 | 4 | 3 |
| α-helix | 234-244 | 11 | |
| β-strand | 247-251 | 5 | 3 |
| α-helix | 256-261 | 6 | |
| α-helix | 267-269 | 3 | |
| β-strand | 273-277 | 5 | 3 |
| α-helix | 280-282 | 3 | |
| β-strand | 288-293 | 6 | 3 |
| β-strand | 296-299 | 4 | 6 |
| α-helix | 305 | 1 | |
| β-strand | 306-308 | 3 | 6 |
| α-helix | 309 | 1 | |
| α-helix | 312-317 | 6 | |
| α-helix | 318-323 | 6 | |
| α-helix | 329-341 | 13 | |
| α-helix | 345-367 | 23 | |
| β-strand | 371-372 | 2 | 7 |
| α-helix | 373-375 | 3 | |
| β-strand | 381-385 | 5 | 7 |
| α-helix | 387-389 | 3 | |
| α-helix | 393-402 | 10 | |
| β-strand | 405-406 | 2 | 1 |
| β-strand | 408-410 | 3 | 7 |
| α-helix | 411-412 | 2 | |
| α-helix | 420-421 | 2 | |
| β-strand | 423-427 | 5 | 7 |
| α-helix | 429-433 | 5 | |
| α-helix | 438-460 | 23 | |
| α-helix | 465-474 | 10 | |
| α-helix | 476-494 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 49-52 | 4 | |
| α-helix | 54-69 | 16 | |
| β-strand | 71-72 | 2 | 8 |
| α-helix | 82-88 | 7 | |
| α-helix | 91-94 | 4 | |
| β-strand | 99-100 | 2 | 9 |
| β-strand | 103-104 | 2 | 9 |
| α-helix | 110-126 | 17 | |
| β-strand | 134-137 | 4 | 10 |
| α-helix | 143-154 | 12 | |
| β-strand | 160-164 | 5 | 10 |
| α-helix | 172-174 | 3 | |
| β-strand | 177 | 1 | 11 |
| β-strand | 182 | 1 | 11 |
| α-helix | 185-189 | 5 | |
| β-strand | 191-195 | 5 | 10 |
| β-strand | 197 | 1 | 12 |
| β-strand | 204 | 1 | 12 |
| α-helix | 206-216 | 11 | |
| β-strand | 220-224 | 5 | 10 |
| α-helix | 234-243 | 10 | |
| β-strand | 247-251 | 5 | 10 |
| α-helix | 253-255 | 3 | |
| α-helix | 256-260 | 5 | |
| α-helix | 267-269 | 3 | |
| β-strand | 273-277 | 5 | 10 |
| α-helix | 280-282 | 3 | |
| β-strand | 288-293 | 6 | 10 |
| β-strand | 296-300 | 5 | 13 |
| β-strand | 305-308 | 4 | 13 |
| α-helix | 311-317 | 7 | |
| α-helix | 318-323 | 6 | |
| α-helix | 329-342 | 14 | |
| α-helix | 345-366 | 22 | |
| β-strand | 371-372 | 2 | 14 |
| α-helix | 373-375 | 3 | |
| β-strand | 381-385 | 5 | 14 |
| α-helix | 387-389 | 3 | |
| α-helix | 393-402 | 10 | |
| β-strand | 405-406 | 2 | 8 |
| β-strand | 408-409 | 2 | 14 |
| β-strand | 423-427 | 5 | 14 |
| α-helix | 429-433 | 5 | |
| α-helix | 438-460 | 23 | |
| α-helix | 465-474 | 10 | |
| α-helix | 476-494 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine hydroxymethyltransferase, mitochondrial | A, B | protein | 476 | Homo sapiens | P34897 (AlphaFold model) |
>5V7I_1 Serine hydroxymethyltransferase, mitochondrial (chains A, B) SNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGLELIASENFCSRAALEAL GSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDPAQWGVNVQPYSGSPANL AVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFESMPYKLNPKTGLIDYNQ LALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVAAKVIPSPF KHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVFPSLQGGPH NHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNHLVLVDLRP KGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDDFRRVVDFI DEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQFARAFPMPGFDEH
| ID | Name | Formula | Copies |
|---|---|---|---|
| GLY | Glycine | C2 H5 N O2 | 1 |
| 8Z1 | (4R)-6-amino-3-methyl-4-(propan-2-yl)-4-[3-(pyrrolidin-1-yl)-5-(trifluoromethyl… | C22 H24 F3 N5 O | 2 |
Water and common crystallization additives (GOL, PEG) are not listed.
Human SHMT inhibitors reveal defective glycine import as a targetable metabolic vulnerability of diffuse large B-cell lymphoma. Ducker, G.S., Ghergurovich, J.M., Mainolfi, N. et al. Proc Natl Acad Sci U S A (2017) 114:11404-11409. DOI 10.1073/pnas.1706617114 · PubMed
Other PDB entries of the same protein (UniProt P34897 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5V7I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.