Human mitochondrial serine hydroxymethyltransferase (SHMT2) in complex with PLP, glycine and AGF362 inhibitor. Determined by X-ray diffraction at 2.47 Å resolution. Released 6 Sept 2023.
Explore 8FJT in 3D Show helices and sheets RCSB PDB PDBe
8FJT contains 52 α-helices and 47 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 49-52 | 4 | |
| α-helix | 54-69 | 16 | |
| β-strand | 71-72 | 2 | 1 |
| α-helix | 82-88 | 7 | |
| α-helix | 91-94 | 4 | |
| β-strand | 99 | 1 | 2 |
| β-strand | 104 | 1 | 2 |
| α-helix | 110-126 | 17 | |
| β-strand | 134-137 | 4 | 3 |
| α-helix | 143-154 | 12 | |
| β-strand | 160-162 | 3 | 3 |
| β-strand | 164 | 1 | 4 |
| α-helix | 166-168 | 3 | |
| α-helix | 172-174 | 3 | |
| β-strand | 177 | 1 | 5 |
| β-strand | 182 | 1 | 5 |
| α-helix | 185-188 | 4 | |
| β-strand | 191-192 | 2 | 3 |
| β-strand | 195 | 1 | 4 |
| β-strand | 197-198 | 2 | 6 |
| β-strand | 203-204 | 2 | 6 |
| α-helix | 206-216 | 11 | |
| β-strand | 220-223 | 4 | 3 |
| α-helix | 234-244 | 11 | |
| β-strand | 247-251 | 5 | 3 |
| α-helix | 253-255 | 3 | |
| α-helix | 256-260 | 5 | |
| α-helix | 267-269 | 3 | |
| β-strand | 273-277 | 5 | 3 |
| α-helix | 280-282 | 3 | |
| β-strand | 288-293 | 6 | 3 |
| β-strand | 296 | 1 | 7 |
| α-helix | 307 | 1 | |
| β-strand | 308 | 1 | 7 |
| α-helix | 309 | 1 | |
| α-helix | 312-317 | 6 | |
| α-helix | 318-323 | 6 | |
| α-helix | 329-342 | 14 | |
| α-helix | 345-367 | 23 | |
| β-strand | 371-372 | 2 | 8 |
| α-helix | 373-375 | 3 | |
| β-strand | 381-385 | 5 | 8 |
| α-helix | 387-389 | 3 | |
| α-helix | 393-402 | 10 | |
| β-strand | 405-406 | 2 | 1 |
| β-strand | 408-410 | 3 | 8 |
| β-strand | 413 | 1 | 9 |
| β-strand | 415 | 1 | 9 |
| β-strand | 423-427 | 5 | 8 |
| α-helix | 429-433 | 5 | |
| α-helix | 438-459 | 22 | |
| α-helix | 465-474 | 10 | |
| α-helix | 476-494 | 19 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 49-52 | 4 | |
| α-helix | 54-69 | 16 | |
| β-strand | 71-72 | 2 | 10 |
| β-strand | 74 | 1 | 11 |
| α-helix | 82-88 | 7 | |
| α-helix | 91-94 | 4 | |
| β-strand | 99-100 | 2 | 12 |
| β-strand | 103-104 | 2 | 12 |
| α-helix | 110-126 | 17 | |
| β-strand | 134-137 | 4 | 13 |
| α-helix | 143-154 | 12 | |
| β-strand | 160-164 | 5 | 13 |
| α-helix | 172-174 | 3 | |
| β-strand | 177 | 1 | 14 |
| β-strand | 182 | 1 | 14 |
| α-helix | 185-187 | 3 | |
| β-strand | 191-195 | 5 | 13 |
| β-strand | 197 | 1 | 15 |
| β-strand | 204 | 1 | 15 |
| α-helix | 206-216 | 11 | |
| β-strand | 220-224 | 5 | 13 |
| α-helix | 234-244 | 11 | |
| β-strand | 247-251 | 5 | 13 |
| α-helix | 256-260 | 5 | |
| α-helix | 265-266 | 2 | |
| α-helix | 267-269 | 3 | |
| β-strand | 273-277 | 5 | 13 |
| β-strand | 288-293 | 6 | 13 |
| β-strand | 296 | 1 | 16 |
| β-strand | 308 | 1 | 16 |
| α-helix | 312-317 | 6 | |
| α-helix | 318-323 | 6 | |
| α-helix | 329-342 | 14 | |
| α-helix | 345-366 | 22 | |
| β-strand | 371-372 | 2 | 11 |
| α-helix | 373-375 | 3 | |
| β-strand | 381-385 | 5 | 11 |
| α-helix | 387-389 | 3 | |
| α-helix | 393-402 | 10 | |
| β-strand | 405-406 | 2 | 10 |
| β-strand | 408-409 | 2 | 11 |
| β-strand | 423-427 | 5 | 11 |
| α-helix | 429-432 | 4 | |
| α-helix | 438-457 | 20 | |
| α-helix | 465-474 | 10 | |
| α-helix | 476-494 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Serine hydroxymethyltransferase, mitochondrial | A, B | protein | 493 | Homo sapiens | P34897 (AlphaFold model) |
>8FJT_1 Serine hydroxymethyltransferase, mitochondrial (chains A, B) MGSSHHHHHHSSGLVPRSNAAQTQTGEANRGWTGQESLSDSDPEMWELLQREKDRQCRGL ELIASENFCSRAALEALGSCLNNKYSEGYPGKRYYGGAEVVDEIELLCQRRALEAFDLDP AQWGVNVQPYSGSPANLAVYTALLQPHDRIMGLDLPDGGHLTHGYMSDVKRISATSIFFE SMPYKLNPKTGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLAD MAHISGLVAAKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTF EDRINFAVFPSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYS LVSGGTDNHLVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPAL TSRQFREDDFRRVVDFIDEGVNIGLEVKSKTAKLQDFKSFLLKDSETSQRLANLRQRVEQ FARAFPMPGFDEH
| ID | Name | Formula | Copies |
|---|---|---|---|
| PLG | N-glycine-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-yl-methane] | C10 H15 N2 O7 P | 1 |
| Y72 | N-{4-[4-(2-amino-4-oxo-3,4-dihydro-5H-pyrrolo[3,2-d]pyrimidin-5-yl)butyl]-3-flu… | C20 H22 F N5 O6 S | 2 |
| GLY | Glycine | C2 H5 N O2 | 1 |
| PLP | Pyridoxal-5'-phosphate | C8 H10 N O6 P | 1 |
Structure-Based Design of Transport-Specific Multitargeted One-Carbon Metabolism Inhibitors in Cytosol and Mitochondria. Nayeen, M.J., Katinas, J.M., Magdum, T. et al. J Med Chem (2023) 66:11294-11323. DOI 10.1021/acs.jmedchem.3c00763 · PubMed
Other PDB entries of the same protein (UniProt P34897 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FJT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.