TRIM-Cyclophilin A B-box 2 and coiled-coil chimera. Determined by X-ray diffraction at 2.31 Å resolution. Released 22 Nov 2017.
Explore 5VA4 in 3D Show helices and sheets RCSB PDB PDBe
5VA4 contains 7 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 95 | 1 | 1 |
| β-strand | 102 | 1 | 1 |
| β-strand | 105-107 | 3 | 2 |
| β-strand | 113-114 | 2 | 2 |
| α-helix | 116-120 | 5 | |
| α-helix | 122-124 | 3 | |
| β-strand | 129-131 | 3 | 2 |
| α-helix | 132-167 | 36 | |
| α-helix | 179-189 | 11 | |
| α-helix | 191-205 | 15 | |
| α-helix | 208-212 | 5 | |
| α-helix | 215-224 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| TRIM5/cyclophilin A V4 fusion protein | A | protein | 141 | Aotus trivirgatus, Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) | P34945 (AlphaFold model), Q68KK2 (AlphaFold model) |
>5VA4_1 TRIM5/cyclophilin A V4 fusion protein (chains A) EEGQKVDHCAHHGEKLVLFCQQDGNVICWLCERSQEHRGHQTFLVEEVAQKYREKLQVAL EMMRQKQKDAETECNQVAKRVPKAPPEEKEALIARGKACGEQTQSVRVLISDLEHRLQGS VMELLQGVDGVIKRIEKVTLQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
General Model for Retroviral Capsid Pattern Recognition by TRIM5 Proteins. Wagner, J.M., Christensen, D.E., Bhattacharya, A. et al. J Virol (2018) 92. DOI 10.1128/JVI.01563-17 · PubMed
Other PDB entries of the same protein (UniProt P34945 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VA4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.