5VAA: Mouse IgG2a Fc T370K mutant

Crystal structure of mouse IgG2a Fc T370K mutant. Determined by X-ray diffraction at 1.55 Å resolution. Released 7 Jun 2017.

Method: X-ray diffraction
Resolution: 1.55 Å
Organism: Mus musculus
Chains: 2
Atoms: 4,021
Mol. weight: 55.15 kDa
Released: 7 Jun 2017

Explore 5VAA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VAA contains 21 α-helices and 38 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	1
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	1
β-strand	274-279	6	2
β-strand	282-284	3	2
β-strand	288-294	7	1
β-strand	299-307	9	1
α-helix	310-314	5
β-strand	319-324	6	2
β-strand	332-336	5	2
α-helix	338-340	3
β-strand	344	1	3
α-helix	345-346	2
β-strand	347-351	5	4
α-helix	355-359	5
β-strand	362-372	11	4
β-strand	373	1	3
β-strand	378-383	6	5
β-strand	386-387	2	5
α-helix	388	1
β-strand	391-393	3	4
α-helix	394-396	3
β-strand	397-398	2	4
β-strand	404-413	10	4
α-helix	414-418	5
β-strand	424-428	5	5
α-helix	433-435	3
β-strand	436-440	5	5

Chain B: 11 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	6
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	6
β-strand	274-279	6	7
β-strand	282-284	3	7
β-strand	288-294	7	6
β-strand	299-307	9	6
α-helix	310-314	5
β-strand	319-324	6	7
β-strand	332-336	5	7
α-helix	338-340	3
β-strand	344	1	8
α-helix	345-346	2
β-strand	347-351	5	9
α-helix	352-354	3
α-helix	355-357	3
β-strand	362-372	11	9
β-strand	373	1	8
β-strand	378-383	6	10
β-strand	386-387	2	10
α-helix	388	1
β-strand	391-393	3	9
α-helix	394-396	3
β-strand	397-398	2	9
β-strand	404-413	10	9
α-helix	414-420	7
β-strand	423-428	6	10
α-helix	433-435	3
β-strand	436-439	4	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ig gamma-2A chain C region, A allele	A, B	protein	226	Mus musculus	P01863 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5VAA_1 Ig gamma-2A chain C region, A allele (chains A, B)
GSCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNN
VEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKG
SVRAPQVYVLPPPEEEMTKKQVTLTCMVKDFMPEDIYVEWTNNGKTELNYKNTEPVLDSD
GSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

Primary citation

Efficient Generation of Bispecific Murine Antibodies for Pre-Clinical Investigations in Syngeneic Rodent Models. Labrijn, A.F., Meesters, J.I., Bunce, M. et al. Sci Rep (2017) 7:2476-2476. DOI 10.1038/s41598-017-02823-9 · PubMed

Other PDB entries of the same protein (UniProt P01863 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3OZ9 1.6 Å, Crystal Structure of anti-gp41 Fab NC-1
2IPU 1.65 Å, PFA1 Fab fragment complexed with Abeta 1-8 peptide
1DQQ 1.8 Å, Crystal structure of anti-lysozyme antibody hyhel-63
1YEJ 1.85 Å, Catalytic antibody complex
1KN2 1.9 Å, Catalytic antibody D2.3 complex
1KN4 1.9 Å, Catalytic antibody D2.3 complex
1YEC 1.9 Å, Structure of a catalytic antibody IGG2A FAB fragment (D2.3)
1YEI 1.9 Å, Catalytic antibody D2.3 complex
1UYW 2.0 Å, Crystal Structure of the antiflavivirus Fab4g2
1YEF 2.0 Å, Structure of IGG2A FAB fragment (D2.3) complexed with substrate analogue
1YEG 2.0 Å, Structure of IGG2A FAB fragment (D2.3) complexed with reaction product
1FE8 2.03 Å, Crystal structure of the von willebrand factor A3 domain in complex with a FAB fragment…

Browse structure collections

About this viewer

MolViewer shows 5VAA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.