Crystal structure of Sugen kinase 223. Determined by X-ray diffraction at 2.95 Å resolution. Released 18 Oct 2017.
Explore 5VE6 in 3D Show helices and sheets RCSB PDB PDBe
5VE6 contains 21 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 948-974 | 27 | |
| α-helix | 988-991 | 4 | |
| β-strand | 992-994 | 3 | 1 |
| β-strand | 1001-1002 | 2 | 1 |
| β-strand | 1006-1013 | 8 | 1 |
| β-strand | 1020-1026 | 7 | 1 |
| β-strand | 1047 | 1 | 2 |
| β-strand | 1050-1059 | 10 | 1 |
| α-helix | 1060-1063 | 4 | |
| β-strand | 1084-1092 | 9 | 1 |
| β-strand | 1096-1099 | 4 | 2 |
| α-helix | 1100-1105 | 6 | |
| α-helix | 1108-1113 | 6 | |
| α-helix | 1115-1138 | 24 | |
| α-helix | 1148-1150 | 3 | |
| β-strand | 1151-1154 | 4 | 2 |
| α-helix | 1209-1210 | 2 | |
| β-strand | 1211-1214 | 4 | 2 |
| α-helix | 1215-1216 | 2 | |
| α-helix | 1240-1242 | 3 | |
| α-helix | 1246-1250 | 5 | |
| α-helix | 1252-1264 | 13 | |
| α-helix | 1270-1272 | 3 | |
| α-helix | 1275-1279 | 5 | |
| α-helix | 1284-1286 | 3 | |
| α-helix | 1288-1289 | 2 | |
| α-helix | 1296-1307 | 12 | |
| α-helix | 1318-1329 | 12 | |
| α-helix | 1348-1369 | 22 | |
| α-helix | 1379-1389 | 11 | |
| α-helix | 1393-1402 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase SgK223 | A | protein | 492 | Homo sapiens | Q86YV5 (AlphaFold model) |
>5VE6_1 Tyrosine-protein kinase SgK223 (chains A) MHHHHHHHHGSENLYFQGSGSTQLQLHGLLSNISSKEGTYAKLGGLYTQSLARLVAKCED LFMGGQKKELHFNENNWSLFKLTCNKPCCDSGDAIYYCATCSEDPGSTYAVKICKAPEPK TVSYCSPSVPVHFNIQQDCGHFVASVPSSMLSSPDAPKDPVPALPTHPPAQEQDCVVVIT REVPHQTASDFVRDSAASHQAEPEAYERRVCFLLLQLCNGLEHLKEHGIIHRDLCLENLL LVHCTLQAGPGPAPAPAPAPAAAAPPCSSAAPPAGGTLSPAAGPASPEGPREKQLPRLII SNFLKAKQKPGGTPNLQQKKSQARLAPEIVSASQYRKFDEFQTGILIYELLHQPNPFEVR AQLRERDYRQEDLPPLPALSLYSPGLQQLAHLLLEADPIKRIRIGEAKRVLQCLLWGPRR ELVQQPGTSEEALCGTLHNWIDMKRALMMMKFAEKAVDRRRGVELEDWLCCQYLASAEPG ALLQSLKLLQLL
Structure of SgK223 pseudokinase reveals novel mechanisms of homotypic and heterotypic association. Patel, O., Griffin, M.D.W., Panjikar, S. et al. Nat Commun (2017) 8:1157-1157. DOI 10.1038/s41467-017-01279-9 · PubMed
Other PDB entries of the same protein (UniProt Q86YV5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VE6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.