8DGN: 14-3-3 epsilon

14-3-3 epsilon bound to phosphorylated PEAK2 (pS826) peptide. Determined by X-ray diffraction at 3.16 Å resolution. Released 7 Jun 2023.

Method: X-ray diffraction
Resolution: 3.16 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,510
Mol. weight: 31.63 kDa
Released: 7 Jun 2023

Explore 8DGN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8DGN contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	39-71	33
α-helix	77-103	27
α-helix	104-108	5
α-helix	115-135	21
α-helix	139-162	24
α-helix	168-179	12
α-helix	180-184	5
α-helix	188-205	18
α-helix	211-213	3
α-helix	215-231	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein epsilon	A	protein	258	Homo sapiens	P62258 (AlphaFold model)
Phosphorylated PEAK2 (pS826) peptide	B	protein	20	Homo sapiens	Q86YV5 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8DGN_1 14-3-3 protein epsilon (chains A)
GSTMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARR
ASWRIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGES
KVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNF
SVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQG
DGEEQNKEALQDVEDENQ

Sequence of entity 2 (B), FASTA

>8DGN_2 Phosphorylated PEAK2 (pS826) peptide (chains B)
PPPLPQKKIVSRAASSPDGF

Primary citation

Structural mapping of PEAK pseudokinase interactions identifies 14-3-3 as a molecular switch for PEAK3 signaling. Roy, M.J., Surudoi, M.G., Kropp, A. et al. Nat Commun (2023) 14:3542-3542. DOI 10.1038/s41467-023-38869-9 · PubMed

Other PDB entries of the same protein (UniProt P62258 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2BR9 1.75 Å, 14-3-3 Protein Epsilon (Human) Complexed to Peptide
3UAL 1.8 Å, Crystal Structure of 14-3-3 epsilon with Mlf1 peptide
7V9B 1.85 Å, Crystal Structure of 14-3-3 epsilon with FOXO3a peptide
3UBW 1.9 Å, Complex of 14-3-3 isoform epsilon, a Mlf1 phosphopeptide and a small fragment hit from a…
29II 2.17 Å, Structure of 14-3-3 epsilon in complex with a peptide derived from AMPK gamma 2
6EIH 2.7 Å, The crystal structure of 14-3-3 epsilon in complex with the phosphorylated NELFE peptide
8DGP 2.7 Å, 14-3-3 epsilon bound to phosphorylated PEAK3 (pS69) peptide
8DP5 3.1 Å, Structure of the PEAK3/14-3-3 complex
7C8E 3.16 Å, Crystal Structure of 14-3-3 epsilon with 9J10 peptide
8DGM 3.2 Å, 14-3-3 epsilon bound to phosphorylated PEAK1 (pT1165) peptide
8Q1S 3.23 Å, Pathogenic mutations of human phosphorylation sites affect protein-protein interactions

Browse structure collections

About this viewer

MolViewer shows 8DGN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.