Crystal structure of Protein Kinase A in complex with the PKI peptide and Aminobenzothiazole based inhibitor. Determined by X-ray diffraction at 1.61 Å resolution. Released 31 Jan 2018.
Explore 5VHB in 3D Show helices and sheets RCSB PDB PDBe
5VHB contains 19 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 20-32 | 13 | |
| α-helix | 41-43 | 3 | |
| β-strand | 44-53 | 10 | 1 |
| β-strand | 56-63 | 8 | 1 |
| β-strand | 69-76 | 8 | 1 |
| α-helix | 77-82 | 6 | |
| α-helix | 86-96 | 11 | |
| β-strand | 104 | 1 | 2 |
| α-helix | 105-106 | 2 | |
| β-strand | 107-112 | 6 | 1 |
| β-strand | 116-122 | 7 | 1 |
| β-strand | 128 | 1 | 2 |
| α-helix | 129-136 | 8 | |
| α-helix | 141-160 | 20 | |
| β-strand | 163-164 | 2 | 3 |
| α-helix | 170-172 | 3 | |
| β-strand | 173-175 | 3 | 2 |
| β-strand | 181-183 | 3 | 2 |
| β-strand | 190-191 | 2 | 3 |
| β-strand | 196 | 1 | 4 |
| α-helix | 203-205 | 3 | |
| α-helix | 208-211 | 4 | |
| β-strand | 216 | 1 | 4 |
| α-helix | 219-234 | 16 | |
| α-helix | 244-253 | 10 | |
| α-helix | 264-273 | 10 | |
| α-helix | 290-293 | 4 | |
| α-helix | 296-298 | 3 | |
| α-helix | 303-307 | 5 | |
| α-helix | 312-313 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-10 | 7 | |
| α-helix | 16-19 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cAMP-dependent protein kinase catalytic subunit alpha | A | protein | 351 | Bos taurus | P00517 (AlphaFold model) |
| PKI peptide | B | protein | 18 | Bos taurus | Q3SX13 (AlphaFold model) |
>5VHB_1 cAMP-dependent protein kinase catalytic subunit alpha (chains A) MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
>5VHB_2 PKI peptide (chains B) TTYADFIASGRTGRRNAI
| ID | Name | Formula | Copies |
|---|---|---|---|
| 9CY | N-[(2S)-1-hydroxy-3-phenylpropan-2-yl]-4-(pyridin-4-yl)benzamide | C21 H20 N2 O2 | 1 |
Design of Aminobenzothiazole Inhibitors of Rho Kinases 1 and 2 by Using Protein Kinase A as a Structure Surrogate. Judge, R.A., Vasudevan, A., Scott, V.E. et al. Chembiochem (2018) 19:613-621. DOI 10.1002/cbic.201700547 · PubMed
Other PDB entries of the same protein (UniProt P00517 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VHB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.