5VI4: IL-33/ST2/IL-1RAcP ternary complex structure

IL-33/ST2/IL-1RAcP ternary complex structure. Determined by X-ray diffraction at 2.79 Å resolution. Released 27 Sept 2017.

Method: X-ray diffraction
Resolution: 2.79 Å
Organism: Mus musculus
Chains: 6
Atoms: 11,304
Mol. weight: 185.66 kDa
Ligands: NAG
Released: 27 Sept 2017

Explore 5VI4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VI4 contains 39 α-helices and 130 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	117-125	9	1
β-strand	130-134	5	1
β-strand	141-145	5	1
β-strand	148	1	2
α-helix	151-154	4
β-strand	156-166	11	1
β-strand	177-185	9	1
β-strand	192-195	4	3
β-strand	201	1	1
β-strand	202-205	4	3
α-helix	213-215	3
β-strand	217-221	5	1
β-strand	227-231	5	1
β-strand	237-242	6	1
β-strand	245-250	6	1
α-helix	256-259	4
β-strand	261-264	4	1

Chain B: 6 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	30-33	4	4
β-strand	36-41	6	5
β-strand	52-53	2	6
β-strand	72-74	3	5
β-strand	77-83	7	5
α-helix	85-87	3
β-strand	90-95	6	6
β-strand	103-107	5	6
β-strand	108-111	4	4
α-helix	112-114	3
α-helix	121-123	3
β-strand	124-131	8	2
β-strand	134	1	2
β-strand	136-138	3	7
α-helix	142-144	3
α-helix	150-151	2
β-strand	152-155	4	2
β-strand	158-159	2	2
β-strand	165-168	4	7
β-strand	171-174	4	7
α-helix	179-181	3
β-strand	183-193	11	2
β-strand	196-209	14	2
β-strand	212	1	8
β-strand	218-221	4	9
β-strand	226-227	2	1
β-strand	237-243	7	9
β-strand	247	1	8
β-strand	252-258	7	1
β-strand	262	1	1
β-strand	287-293	7	9
β-strand	306-312	7	1
β-strand	315-322	8	1

Chain C: 8 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	26-29	4	10
α-helix	34	1
β-strand	35-38	4	10
β-strand	43-46	4	11
α-helix	49-52	4
α-helix	58-63	6
β-strand	67-74	8	10
β-strand	81-82	2	10
α-helix	83-84	2
β-strand	92-95	4	11
β-strand	98-101	4	11
α-helix	106-108	3
β-strand	110-117	8	10
β-strand	122-132	11	10
α-helix	144-145	2
β-strand	146-150	5	12
β-strand	156-159	4	13
β-strand	174-179	6	12
β-strand	182-184	3	12
β-strand	190-193	4	13
β-strand	196-199	4	13
α-helix	204-206	3
β-strand	208-218	11	12
β-strand	221-234	14	12
α-helix	237-239	3
β-strand	244-247	4	14
β-strand	254	1	15
β-strand	264-270	7	14
β-strand	279-284	6	16
β-strand	300-304	5	14
β-strand	310-316	7	14
β-strand	330-336	7	16
β-strand	339-345	7	16
β-strand	347	1	15

Chain D: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	117-125	9	17
β-strand	130-133	4	17
β-strand	142-145	4	17
β-strand	148	1	18
α-helix	152-154	3
β-strand	155-166	12	17
β-strand	177-185	9	17
β-strand	192-195	4	19
β-strand	201	1	17
β-strand	202-205	4	19
α-helix	213-215	3
β-strand	217-221	5	17
β-strand	227-231	5	17
β-strand	237-242	6	17
β-strand	245-250	6	17
α-helix	256-259	4
β-strand	261-264	4	17

Chain E: 9 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	28-33	6	20
β-strand	36-41	6	21
β-strand	52-56	5	20
β-strand	71-74	4	21
β-strand	77-83	7	21
α-helix	85-87	3
β-strand	89-95	7	20
β-strand	103-111	9	20
α-helix	112-114	3
α-helix	119-120	2
α-helix	121-123	3
β-strand	124-131	8	18
β-strand	136-138	3	22
α-helix	139	1
α-helix	142-144	3
β-strand	147	1	18
α-helix	150-151	2
β-strand	152-155	4	18
β-strand	158-159	2	18
β-strand	165-168	4	22
β-strand	171-174	4	22
α-helix	179-181	3
β-strand	183-193	11	18
β-strand	196-209	14	18
β-strand	212-221	10	23
β-strand	226	1	17
β-strand	237-247	11	23
β-strand	252-258	7	17
β-strand	262	1	17
β-strand	271-274	4	23
β-strand	287-293	7	23
α-helix	301-303	3
β-strand	306-312	7	17
β-strand	315-321	7	17

Chain F: 10 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	26-29	4	24
α-helix	34	1
β-strand	35-38	4	24
β-strand	43-46	4	25
α-helix	48-50	3
α-helix	58-63	6
β-strand	67-74	8	24
β-strand	81-82	2	24
α-helix	83-84	2
α-helix	88-90	3
β-strand	92-95	4	25
β-strand	98-101	4	25
α-helix	106-108	3
β-strand	110-117	8	24
β-strand	122-132	11	24
α-helix	144-145	2
β-strand	146-150	5	26
β-strand	156-159	4	27
β-strand	174-179	6	26
β-strand	182-184	3	26
β-strand	190-193	4	27
β-strand	196-199	4	27
α-helix	204-206	3
β-strand	208-218	11	26
β-strand	221-234	14	26
α-helix	237-239	3
β-strand	244-247	4	28
β-strand	265-270	6	28
β-strand	279-284	6	29
β-strand	300-304	5	28
β-strand	310-315	6	28
α-helix	325-327	3
β-strand	330-336	7	29
β-strand	339-345	7	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-33	A, D	protein	158	Mus musculus	Q8BVZ5 (AlphaFold model)
Interleukin-1 receptor-like 1	B, E	protein	309	Mus musculus	P14719 (AlphaFold model)
Interleukin-1 receptor accessory protein	C, F	protein	339	Mus musculus	Q61730 (AlphaFold model)

Sequence of entity 1 (A, D), FASTA

>5VI4_1 Interleukin-33 (chains A, D)
SIQGTSLLTQSPASLSTYNDQSVSFVLENGSYVINVDDSGKDQEQDQVLLRYYESPSPAS
QSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVS
FESKNLPGTYIGVKDNQLALVEEKDESSNNIMFKLSKI

Sequence of entity 2 (B, E), FASTA

>5VI4_2 Interleukin-1 receptor-like 1 (chains B, E)
ETGSKSSWGLENEALIVRCPQRGRSTYPVEWYYSDTNESIPTQKRNRIFVSRDRLKFLPA
RVEDSGIYACVIRSPNLNKTGYLNVTIHKKPPSCNIPDYLMYSTVRGSDKNFKITCPTID
LYNWTAPVQWFKNCKALQEPRFRAHRSYLFIDNVTHDDEGDYTCQFTHAENGTNYIVTAT
RSFTVEEKGFSMFPVITNPPYNHTMEVEIGKPASIACSACFGKGSHFLADVLWQINKTVV
GNFGEARIQEEEGRNESSSNDMDCLTSVLRITGVTEKDLSLEYDCLALNLHGMIRHTIRL
RRKHHHHHH

Sequence of entity 3 (C, F), FASTA

>5VI4_3 Interleukin-1 receptor accessory protein (chains C, F)
ETGSERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKYNYSTAHSSGLTLIWYWTRQDR
DLEEPINFRLPENRISKEKDVLWFRPTLLQDTGQYTCMLRNTTYCSKVAFPLEVVQKDSC
FNSAMRFPVHKMYIEHGIHKITCPNVDGYFPSSVKPSVTWYKGCTEIVDFHNVLPEGMQL
SFFIPLVSNNGQYTCVVTYPENGRLFHLTRTVTVKVVGSPKDALPPQIYSPNDRVVYEKE
PGEELVIPCKVYFSFIMDSHNEVWWTIDGKKPDDVTVDITINESVSYSSTEDETRTQILS
IKKVTPEDLRRNYVCHARNTKGEAEQAAKVKQKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

IL-1 Family Cytokines Use Distinct Molecular Mechanisms to Signal through Their Shared Co-receptor. Gunther, S., Deredge, D., Bowers, A.L. et al. Immunity (2017) 47:510-523.e4. DOI 10.1016/j.immuni.2017.08.004 · PubMed

Other PDB entries of the same protein (UniProt Q8BVZ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8Q5R 2.1 Å, HpARI bound to mouse IL-33

Browse structure collections

About this viewer

MolViewer shows 5VI4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.