5VQA: Human TRIP13, ATP-bound form

Structure of human TRIP13, ATP-bound form. Determined by X-ray diffraction at 2.54 Å resolution. Released 14 Jun 2017.

Method: X-ray diffraction
Resolution: 2.54 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,056
Mol. weight: 49.11 kDa
Ligands: ATP
Released: 14 Jun 2017

Explore 5VQA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VQA contains 16 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	21-27	7	1
α-helix	35-49	15
β-strand	57-58	2	1
α-helix	64-69	6
β-strand	70-76	7	1
β-strand	95-100	6	1
β-strand	103	1	2
β-strand	122-127	6	3
β-strand	129	1	2
α-helix	130-132	3
α-helix	135-138	4
α-helix	145-162	18
β-strand	174-178	5	3
α-helix	185-199	15
β-strand	206-212	7	3
α-helix	228-240	13
β-strand	245-251	7	3
α-helix	255-259	5
α-helix	273-287	15
β-strand	293-299	7	3
β-strand	315-318	4	3
α-helix	321-323	3
α-helix	324-340	17
β-strand	344	1	4
α-helix	353-358	6
α-helix	368-379	12
α-helix	385-395	11
α-helix	396-400	5
β-strand	405	1	4
α-helix	407-429	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pachytene checkpoint protein 2 homolog	A	protein	432	Homo sapiens	Q15645 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5VQA_1 Pachytene checkpoint protein 2 homolog (chains A)
MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTE
FDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENII
AANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGP
PGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLI
DDKDALVFVLIDQVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSN
ITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIG
FIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK
QFEERKKLAAYI

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

The AAA+ ATPase TRIP13 remodels HORMA domains through N-terminal engagement and unfolding. Ye, Q., Kim, D.H., Dereli, I. et al. EMBO J (2017) 36:2419-2434. DOI 10.15252/embj.201797291 · PubMed

Other PDB entries of the same protein (UniProt Q15645 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5WC2 2.5 Å, Crystal Structure of ADP-bound human TRIP13
6LK0 2.6 Å, Crystal structure of human wild type TRIP13
5VQ9 3.02 Å, Structure of human TRIP13, Apo form
7L9P 3.6 Å, Structure of human SHLD2-SHLD3-REV7-TRIP13(E253Q) complex
6F0X 4.6 Å, Cryo-EM structure of TRIP13 in complex with ATP gamma S, p31comet, C-Mad2 and Cdc20

Browse structure collections

About this viewer

MolViewer shows 5VQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.