Structure of human TRIP13, ATP-bound form. Determined by X-ray diffraction at 2.54 Å resolution. Released 14 Jun 2017.
Explore 5VQA in 3D Show helices and sheets RCSB PDB PDBe
5VQA contains 16 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 21-27 | 7 | 1 |
| α-helix | 35-49 | 15 | |
| β-strand | 57-58 | 2 | 1 |
| α-helix | 64-69 | 6 | |
| β-strand | 70-76 | 7 | 1 |
| β-strand | 95-100 | 6 | 1 |
| β-strand | 103 | 1 | 2 |
| β-strand | 122-127 | 6 | 3 |
| β-strand | 129 | 1 | 2 |
| α-helix | 130-132 | 3 | |
| α-helix | 135-138 | 4 | |
| α-helix | 145-162 | 18 | |
| β-strand | 174-178 | 5 | 3 |
| α-helix | 185-199 | 15 | |
| β-strand | 206-212 | 7 | 3 |
| α-helix | 228-240 | 13 | |
| β-strand | 245-251 | 7 | 3 |
| α-helix | 255-259 | 5 | |
| α-helix | 273-287 | 15 | |
| β-strand | 293-299 | 7 | 3 |
| β-strand | 315-318 | 4 | 3 |
| α-helix | 321-323 | 3 | |
| α-helix | 324-340 | 17 | |
| β-strand | 344 | 1 | 4 |
| α-helix | 353-358 | 6 | |
| α-helix | 368-379 | 12 | |
| α-helix | 385-395 | 11 | |
| α-helix | 396-400 | 5 | |
| β-strand | 405 | 1 | 4 |
| α-helix | 407-429 | 23 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pachytene checkpoint protein 2 homolog | A | protein | 432 | Homo sapiens | Q15645 (AlphaFold model) |
>5VQA_1 Pachytene checkpoint protein 2 homolog (chains A) MDEAVGDLKQALPCVAESPTVHVEVHQRGSSTAKKEDINLSVRKLLNRHNIVFGDYTWTE FDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENII AANHWVLPAAEFHGLWDSLVYDVEVKSHLLDYVMTTLLFSDKNVNSNLITWNRVVLLHGP PGTGKTSLCKALAQKLTIRLSSRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQKIQDLI DDKDALVFVLIDQVESLTAARNACRAGTEPSDAIRVVNAVLTQIDQIKRHSNVVILTTSN ITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEELMKCQIIYPRQQLLTLRELEMIG FIENNVSKLSLLLNDISRKSEGLSGRVLRKLPFLAHALYVQAPTVTIEGFLQALSLAVDK QFEERKKLAAYI
| ID | Name | Formula | Copies |
|---|---|---|---|
| ATP | Adenosine-5'-triphosphate | C10 H16 N5 O13 P3 | 1 |
The AAA+ ATPase TRIP13 remodels HORMA domains through N-terminal engagement and unfolding. Ye, Q., Kim, D.H., Dereli, I. et al. EMBO J (2017) 36:2419-2434. DOI 10.15252/embj.201797291 · PubMed
Other PDB entries of the same protein (UniProt Q15645 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5VQA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.